(data stored in ACNUC7421 zone)

EMBL: CP001389.PE109

CP001389.PE109       Location/Qualifiers
FT   CDS_pept        117773..118798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01100"
FT                   /product="periplasmic binding protein/LacI
FT                   transcriptionalregulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23913"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF76"
FT                   /protein_id="ACP23913.1"
FT                   /translation="MKKTVLSTAFGALALGVAFASPSQAADVSACLITKTDTNPFFVKM
FT                   KEGASAKAQELGVTLKAYAGKVDGDHDSQVAAIESCIADGAKGILIAASDTKAIVDQVK
FT                   KAQAAGVLVIALDTPLDPATAADATFATDNLLAGKLIGQWAAATMGENAKTAKIGFLDL
FT                   TPSQPTVDVLRDQGFMIGFGIDPKDPNKIGDEDDPRIVGHDVTNGNEEGGRTAMENLLQ
FT                   KDPDINVIHTINEPAAVGAYQALKAVGKEKDVLIVSVDGGCPGVKSVTEGVIGATSQQY
FT                   PLMMAALGIEAIKKFAETGEKPKPTEGKDFFDTGVALVTDKPAAGVESIDTKVGTEKCW
FT                   G"
     atgaagaaga ctgttctttc caccgcattc ggcgcgctcg ctcttggcgt tgccttcgcg        60
     tcgccgtcgc aggcggccga cgtctctgcc tgcctcatca ccaagaccga caccaacccc       120
     ttcttcgtga agatgaagga aggcgcgagc gccaaggccc aggaactcgg cgtcacgctg       180
     aaggcctatg ccggcaaggt cgacggtgat cacgacagcc aggtcgctgc tatcgaatcc       240
     tgcatcgccg acggcgcgaa gggtattctc atcgctgcct ccgacaccaa ggcgatcgtc       300
     gaccaggtga agaaggcgca ggccgcgggc gttctcgtga tcgccctcga cacgcccctc       360
     gatccggcga cggctgccga cgcgacattc gcgaccgaca atcttctcgc aggcaagctg       420
     atcggccagt gggccgccgc gacgatgggc gaaaacgcca agacagcaaa gatcggcttc       480
     ctcgatctta ccccgtcgca gccgaccgtc gacgtgttgc gtgaccaggg cttcatgatc       540
     ggcttcggta tcgatcccaa ggatccgaac aagatcggcg acgaggacga cccgcgcatc       600
     gtcggccatg acgtgacgaa cggcaacgag gaaggcggcc gcacggctat ggaaaacctt       660
     ctgcagaagg atccggacat caacgtcatt cacaccatca atgagccggc cgccgtcggc       720
     gcctaccagg cgctgaaagc cgtcggcaag gagaaggacg tgctgatcgt gtcggtcgac       780
     ggcggctgcc cgggcgtcaa gtcggttacc gaaggcgtga tcggtgccac ctcgcagcaa       840
     tatccgctga tgatggctgc actcggcatc gaggcgatca agaaattcgc cgagactggc       900
     gagaagccga agccgaccga aggcaaggac ttcttcgaca ccggcgtcgc gctcgtcacc       960
     gacaagccgg ccgccggcgt cgaatcgatc gacacgaagg tcggtacgga gaagtgctgg      1020
     ggctga                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page