(data stored in ACNUC7421 zone)

EMBL: CP001389.PE115

CP001389.PE115       Location/Qualifiers
FT   CDS_pept        123551..124477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01160"
FT                   /product="fructokinase protein"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23919"
FT                   /db_xref="GOA:C3MF82"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF82"
FT                   /protein_id="ACP23919.1"
FT                   /translation="MIVCCGEALIDMLPRETAAGESAFAPYAGGAIFNTAIALGRLGIP
FT                   TGFFTGLSDDMFGDILRETLKAANVDFGPCATLPLHTTLAFVKLVHGHASYAFFDENTA
FT                   GRMITTEHLPALGDFCEALHFGAISLIPEPCGSTYEALMTREHEKRVISFDPNIRPGFI
FT                   TDREAHLARMNRMAAMSDIIKFSDEDLAWFGMEGSHDALAAEWLKRGPKLVLITRGADG
FT                   AVGYTKNHKVEVASERVTVVDTVGAGDTFDAGVLAALKLNNLLTKEQVANLSDEAVRQA
FT                   LALGAKAAAVTVSRAGANPPWKYEIGL"
     atgatcgttt gttgcggaga ggccctgatc gacatgctgc cgcgcgagac cgcggccggg        60
     gaaagcgcct ttgcgcccta tgccggcggc gccatcttca acaccgcgat cgcgcttgga       120
     cggctcggca ttccgaccgg ctttttcacc gggctctccg acgacatgtt cggcgacatc       180
     ctgcgcgaga cgctgaaggc ggcgaatgtc gatttcggcc cctgtgccac gctgccgctc       240
     cacaccacgc tcgccttcgt caagcttgtc catgggcatg cgagctatgc cttctttgac       300
     gagaacactg ccggccggat gatcaccacg gagcatctgc cggcgctcgg cgatttctgc       360
     gaggcgctgc acttcggcgc gatcagcctg atccccgagc cctgcggctc gacctacgaa       420
     gcgctgatga cgcgcgagca cgaaaagcgg gtgatttcct tcgatcccaa catccggccc       480
     ggcttcatca cggaccgaga ggcgcacctc gcccgcatga accgcatggc ggcaatgtct       540
     gacatcatca agttttccga cgaggatcta gcctggttcg gcatggaggg cagccacgat       600
     gcgcttgcgg ccgagtggct gaagcgcggc ccgaagctgg tgttgatcac ccggggcgcc       660
     gacggcgccg tcggctatac gaagaaccac aaggtcgaag tcgcaagcga gcgcgtgacg       720
     gtggtcgaca cggtcggcgc cggcgacacc ttcgatgccg gcgtgctggc cgcgctgaag       780
     ctcaacaacc tgctgaccaa ggagcaggtc gcaaacctga gcgacgaggc ggtccggcaa       840
     gcgctggcgc ttggtgccaa ggcagcggcc gtgaccgtgt cgcgcgcagg cgccaatccg       900
     ccgtggaaat acgagatcgg gctctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page