(data stored in ACNUC7421 zone)

EMBL: CP001389.PE118

CP001389.PE118       Location/Qualifiers
FT   CDS_pept        128845..130020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01190"
FT                   /product="predicted transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23922"
FT                   /db_xref="GOA:C3MF85"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF85"
FT                   /protein_id="ACP23922.1"
FT                   /translation="MQLGNRERENPPVEPRLFGQPAHSRSALVLPISAARWMLVLILLA
FT                   GVYFFHGFVVPVLAAVVIGFASWPIYRRLLQALNGNRTLAATIAIISVIAFIVVPISIA
FT                   AAYAIDEVRDWLVWAVETNVNGAPVPAWLTTIPVAGAWLGQQWVKYVGHPGALGELVQL
FT                   VSGSNIGNIYRGVLVIGASAFQSFLTLLFMLITLFFVYRDGHSFSKQLDRLGEQIFPMR
FT                   WERLSRVVPLTISSTVTGMGIIAIGEGIVLGVAYWLAGVPSPVTLGIITGLMALIPGGA
FT                   PLCFTLVSIYLVASGSPFHGVALFAWGTTELFIVDKTLRPRLVGGPIKLPFLPTFFGLV
FT                   GGVKTMGFLGLFVGPVLMALLVAIWREWMHEVANQPEPTANPISRVDIAAK"
     gtgcaattgg gcaatcgtga gcgagaaaat cccccggtgg agccgcggct cttcgggcag        60
     cctgcccatt cgcgctcggc cctcgtcctg ccgatctcgg cggcccgttg gatgctcgtc       120
     ctcatcctgc tggccggcgt ctatttcttc catggcttcg tcgtgccggt gctggccgcc       180
     gtcgtcatcg gctttgcgag ctggcccatc taccgtcgcc tgcttcaggc cctgaacggc       240
     aatcgcacct tggcggcgac cattgcgatc atctccgtca tcgcctttat cgtcgtgccc       300
     atctcgattg ccgcggccta tgcgatcgac gaggtgcgcg attggctcgt ctgggcggtg       360
     gaaaccaacg tcaatggggc gccggtcccg gcctggctga cgaccatccc ggtggcgggc       420
     gcctggctcg gtcagcaatg ggtgaaatat gtcgggcatc cgggcgcgct cggcgaactg       480
     gttcagctcg tcagcggctc caatatcggc aacatctacc gcggtgtgct ggtgattggc       540
     gcctccgcct tccagtcctt cctgacactg ctcttcatgc tgatcacgct gttcttcgtc       600
     tatcgggacg gccattcctt ctcaaagcag ctcgatcgtc tcggcgagca gattttcccg       660
     atgcgctggg agcgcctgtc gcgggtcgtg ccgctgacca tcagctcgac tgtgaccggc       720
     atgggcatca tcgcgatcgg cgaaggcatc gttctcggtg tcgcctattg gctggccggg       780
     gtgccgtcgc cggtgacgct cggcatcatc accggtctca tggcgctcat tccgggcggc       840
     gcaccgctct gcttcaccct ggtgtcgatc tatctggtgg cgagcggctc gccttttcac       900
     ggcgtggcgc tcttcgcctg gggtacgacg gagctcttca tcgtcgacaa gacgcttcgt       960
     ccaaggctcg tcggcggccc gatcaagctg cccttcctgc cgaccttctt cggccttgtc      1020
     ggcggcgtca agacgatggg ttttcttggt cttttcgtcg gtccggtgct gatggcgctg      1080
     ctcgtcgcaa tctggcggga gtggatgcac gaggtggcga accagccgga gccgacggca      1140
     aatccgatct cccgggtcga catcgccgcg aaatag                                1176
//

If you have problems or comments...

PBIL Back to PBIL home page