(data stored in ACNUC7421 zone)

EMBL: CP001389.PE119

CP001389.PE119       Location/Qualifiers
FT   CDS_pept        130126..132810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01200"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23923"
FT                   /db_xref="GOA:C3MF86"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF86"
FT                   /protein_id="ACP23923.1"
FT                   /translation="MPEIDRDPASRPDPDALLALAEKGGRGKLTVFLGAAPGVGKTYAM
FT                   LMRAQRLKEEGADIVIGLVETHGRSETAALLEGLEVLPRREVAHGGRTLHEFDLDAALA
FT                   RHPRIIVVDELAHTNFGESRHPKRYQDIEELVDAGIDVWTALNIQHLESLSDIVAQIAG
FT                   VPVRERIPDTVLNRADEVLLVDLPPAELIDRLKEGKVYLPDSAKRAVDNFFRLGNLTAL
FT                   RELALRRTADRVDDQMVDYLKQNAIEGPWPASERLLVCIGPDPLSEKVVRTASRLASGL
FT                   NADWIVVSVERADREAADGEAMRQLDETFRLAEQLGAETRRIIGSDFVEEILKLARREN
FT                   ATQIVIGARRHRFPLNLFRASLPDALAKRVSGIGIHLVTGKIEPVARTRRRSKQLLPEG
FT                   LERALAIAGGTVGLATVLGLLIEQFIILQNISLLYLLAVLASAVYAGYFAALAAALFSV
FT                   VAYNFFFIEPVNTFTVAEPHEVFALFVFLAAAALAGGLASRIREQAKTARNRATATQAL
FT                   YDFSRKLSGTANADDVLWAAVTQMQSTLRRNAVMLLPEDGDIALRAAWPPDTELTVSDM
FT                   IAARWAFEKKEAAGNDTGTLPNSPFQFRPLMSPQGVVGVCGFLQEDSPLEINEERALAA
FT                   ILDQTAIAVDRARLSRESLDQAAQLEGEKFRAALLSSLSHDLTTPLATIGSAVISLRQL
FT                   GEGTPKDAREDLLKSIEEESGRLTRFVTNLLDMNRIEAGTINARRDRVDVAEVVHDAVE
FT                   RARKYFPGRVFETSIALGLPAMRGDGVLLGQVLFNLLDNANRFGGDEPVSIYARREGDE
FT                   VVLSVTDLGKGIAPADLEHVFDKFFRKGKPDGRSLGTGLGLTISRSFVEAMGGRIKAES
FT                   PALRRRGTRISMRFPAAEAELSN"
     atgcccgaga ttgatcgcga cccggcaagc cgccccgatc ccgatgccct gctggcgctg        60
     gccgaaaagg gcgggcgagg gaagctgacg gtattcctcg gcgccgcccc cggcgtcgga       120
     aagacctacg ccatgctgat gcgggcgcag cgcctcaagg aagagggcgc cgatatcgtc       180
     atcggacttg tcgagacgca tgggcgcagc gaaaccgcgg cgctgctcga agggctcgag       240
     gtcttgccgc gccgcgaagt ggcgcatggc ggccgtaccc tccacgaatt cgatctcgat       300
     gccgcattgg cgcgccatcc gcggatcatt gtcgtcgatg aactcgccca cacgaatttc       360
     ggcgaaagcc gtcaccccaa gcgctatcag gacatcgagg aactggtgga tgccggcatc       420
     gatgtctgga cggcgctcaa catccagcat cttgaaagcc tgtcggacat cgtcgcccag       480
     attgccggcg tgcccgtacg cgagcgcatt cccgacacgg tgctgaaccg tgccgacgag       540
     gtgctgctgg tggacctgcc gccggccgaa ctgatcgacc ggctgaagga aggcaaggtt       600
     tacctgcccg acagtgccaa gcgggcggtg gacaacttct tccggctcgg caatctgacg       660
     gcgctgcgcg agttggcgct gaggcgcacc gccgaccggg tcgacgacca gatggtcgac       720
     tacctcaagc agaacgccat agagggtccc tggccggcca gcgaaaggct tctcgtctgc       780
     atcggcccgg acccgctctc ggaaaaggtg gtgaggacgg cgagccggct ggcctctggc       840
     ctcaatgccg attggatcgt cgtttccgtc gagcgcgcgg atcgcgaggc ggccgacggc       900
     gaggcgatgc gccagctcga cgagaccttc cgtctcgccg agcaattggg cgccgaaacg       960
     cgccgcatca tcggcagcga tttcgtcgag gagatcctga agcttgcgag gcgcgagaac      1020
     gcgacgcaaa tcgtcatcgg cgcgcggcgg caccggttcc cgctgaacct gttccgcgcc      1080
     tccttgcccg acgcgttggc caagcgcgtg tcgggaatcg gcatccatct cgtcacaggc      1140
     aagatcgagc cggtcgccag gacgcgccgg agaagcaagc agctgctgcc ggagggattg      1200
     gagcgagcgc tcgccatagc cggtggcacc gtcgggctcg cgacggtgct cggcctgctg      1260
     atcgagcagt tcattatcct gcagaatatt tcgcttctct atctgctcgc ggtgcttgct      1320
     tcggcggttt acgccggcta cttcgcggcc ctggcggcgg cgctgttttc cgttgtcgct      1380
     tacaatttct tcttcatcga gccggtcaac acgttcaccg tggccgagcc gcacgaggtt      1440
     ttcgctcttt tcgtcttcct ggcggccgcg gcgctcgccg gcggccttgc ctcgcgcatt      1500
     cgcgaacagg cgaagaccgc aagaaacagg gcgacggcaa cccaggcact ctatgatttt      1560
     tcccgcaagc tttccggcac cgccaatgcc gacgacgtgc tgtgggcggc cgtcacccag      1620
     atgcaatcga cgctgaggcg caacgctgtc atgttgctgc ccgaggatgg agatatcgcc      1680
     ttgcgcgcgg cctggccgcc ggacaccgaa ctgaccgtca gcgacatgat cgcggcgcgc      1740
     tgggctttcg agaagaagga ggcggccggc aatgataccg gcacgctgcc gaacagcccg      1800
     tttcagttca ggccgctgat gagcccgcag ggtgtcgtcg gggtttgcgg ctttttgcag      1860
     gaggacagtc ctctcgagat caatgaggag cgggctcttg ccgcgatcct cgaccagacc      1920
     gcgatcgccg tcgaccgggc acggctgtcg cgcgaaagcc tcgatcaggc tgcccagctc      1980
     gagggcgaga aattccgtgc cgcgcttctt tcgtcgctct cccacgacct cacgacgcct      2040
     ttggcgacaa ttggcagcgc cgtgatcagt cttcgccagc ttggcgaagg aacgccgaag      2100
     gatgcccggg aggaccttct gaagtcgatc gaggaggaaa gcggcaggct gacacgcttc      2160
     gtcaccaacc tgctcgacat gaaccggatc gaggccggta cgatcaatgc ccggcgtgat      2220
     cgggtcgatg tggcggaggt ggtgcatgat gccgtggaac gggcccggaa atatttcccc      2280
     ggccgcgtct tcgagaccag catcgccttg ggcctgccgg cgatgcgcgg cgacggcgtg      2340
     ctgcttggcc aggtcctctt caatctgctc gacaatgcga atcggttcgg cggcgacgaa      2400
     cccgtcagca tctatgcccg acgcgagggc gatgaggtcg tgctgtcggt gacggacctc      2460
     ggcaagggca tcgcgcccgc cgatctcgag cacgtcttcg acaagttctt ccgcaaggga      2520
     aaaccggatg gccgctcgct cggcacgggc ctcggcctta cgatcagcag gagcttcgtc      2580
     gaggcgatgg gcgggcggat caaagcggag agcccggcgc tgcgccgccg cggcacgcgg      2640
     atttccatgc gcttcccggc ggccgaggcg gagctctcga actga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page