(data stored in ACNUC7421 zone)

EMBL: CP001389.PE123

CP001389.PE123       Location/Qualifiers
FT   CDS_pept        complement(135218..135709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23927"
FT                   /db_xref="InterPro:IPR016541"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF90"
FT                   /protein_id="ACP23927.1"
FT                   /translation="MIYIVDTSSLRELERYYNDIFPTFWKLFQAEVDSGSVVSVREVLR
FT                   ELEACPETNVIAWAKHNSGIFKPPAPAEAAFVGQIFALPHFQQLISSKAQMTGQPVADP
FT                   FLIAAAKVCSGTVVTQERFKPNSAKIPNVCERHRVHDFRGFLEGQALEFLANVTWGWDT
FT                   "
     atgatttata tcgtggacac tagcagcctt cgtgagcttg aacggtatta caacgacata        60
     tttccgacct tctggaagct attccaggca gaggtggata gcggtagcgt ggtgtctgtt       120
     cgcgaagtgc tacgcgaact tgaagcctgc cccgagacaa atgtgatagc gtgggcgaag       180
     cataattctg gaatattcaa gcctcccgca ccagcggaag cagcattcgt cgggcaaatt       240
     tttgcacttc ctcactttca acaattgatc tcttctaaag cgcaaatgac cggccagccg       300
     gttgcagacc cttttctgat tgccgccgcg aaggtctgca gtggcacggt agttacgcag       360
     gaacgtttca agccaaactc cgcaaaaatt ccgaacgttt gcgaacggca tcgcgtgcac       420
     gactttcgag ggtttcttga aggccaagcg ctggagtttt tagcaaacgt tacgtggggg       480
     tgggatacct ag                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page