(data stored in ACNUC7421 zone)

EMBL: CP001389.PE124

CP001389.PE124       Location/Qualifiers
FT   CDS_pept        complement(135706..136875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01250"
FT                   /product="conserved hypothetical protein contains
FT                   helix-turn-helix type 3 domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23928"
FT                   /db_xref="GOA:C3MF91"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF91"
FT                   /protein_id="ACP23928.1"
FT                   /translation="MPGIQPALLKWARESAHLSTEEVAGRLKKSVEEIDAWESGTDAPS
FT                   YAQLEKLAYELYKRPLAIFFLPSPPKEPRPEAEFRALPDSDLRNLRRDTVLLIRRARAY
FT                   QASLIELFGGSSPTAEPLWKQVEIDASRPSARQAAVVRASLGVPAPGAREWGAPDGDEA
FT                   LKIWRKAVEARGVFVFKDTFKQSEISGFCLEHSELPIVVINNSTTKTRQIFSLLHELAH
FT                   VLMGRRAISTFDEAPLNRLSPAEQRIERFCNQIAADILVPPDDFAAQVSGLPQNVEALP
FT                   SDAFAALAARYRVSREVILRRFRDADRVSQAFYEKRKREWDGQKIHKGSSGGSFYSTKG
FT                   AYLSERLMSEVFARYGRRQINVDEAAEFIGVKPKQVDELESRFLRGMAA"
     ttgcccggca ttcaaccggc gctcctaaaa tgggcgcggg aatcggcaca cctttcaact        60
     gaagaagtgg ccgggcgcct caagaagtcg gtcgaagaga tcgacgcttg ggagtccggg       120
     actgatgcgc cctcgtatgc acagctagag aagcttgcat atgagcttta caaacgacca       180
     ctggcgattt ttttcctgcc gtcaccccct aaggaaccca ggccagaagc tgaattccgc       240
     gctttgcctg attccgacct ccgcaatctg cgccgcgaca ccgtgttgct gatccgacgc       300
     gcgcgcgcct atcaggcgtc tcttatcgag ctatttggtg ggagttcgcc tacagccgaa       360
     ccgctgtgga aacaagtgga aatcgacgct tcaaggccca gcgcgcggca agccgcagtg       420
     gtgcgcgctt cacttggtgt tcccgcaccc ggtgcccgcg aatggggtgc cccagatggt       480
     gatgaagcgt tgaagatttg gcgcaaagcc gtcgaagcta gaggcgtttt cgtattcaag       540
     gacaccttca agcaaagtga aatatcggga ttctgcttag aacattccga attaccgata       600
     gtggtgatca acaacagcac tacgaagacc cggcaaattt tcagtttgct acacgaactc       660
     gctcacgtcc tgatgggtag gcgcgcgata agcactttcg atgaagcgcc cctaaatcgg       720
     ttgtctccgg cagagcagag gatagagcgt ttctgtaatc agatcgctgc cgatatttta       780
     gttcctcctg atgatttcgc cgcgcaggtg tccggacttc cgcaaaacgt cgaggccctg       840
     ccgtcagatg cctttgccgc actagctgcg cgctatcgcg tcagccgtga ggttattctg       900
     cggcggtttc gcgatgcgga ccgcgtcagt caagcgttct acgagaagcg caagcgcgag       960
     tgggacggcc agaagatcca caagggaagc tctggcggca gcttctattc tacgaagggc      1020
     gcctatctca gcgaacggct tatgagcgag gtgttcgctc gctatggccg ccgccagatc      1080
     aacgtagatg aagccgccga gttcataggc gtaaagccca agcaggttga cgagttggag      1140
     agccggttcc tgcgcgggat ggccgcatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page