(data stored in ACNUC7421 zone)

EMBL: CP001389.PE125

CP001389.PE125       Location/Qualifiers
FT   CDS_pept        137338..138546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01260"
FT                   /product="phage integrase-like protein contains catalytic
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23929"
FT                   /db_xref="GOA:C3MF92"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF92"
FT                   /protein_id="ACP23929.1"
FT                   /translation="MARPLNKLTAVAVKNASAGKHSDGGGLWLHKREDGGSQWILRVNV
FT                   HGRRREMGLGSASDVSLKEAREAAERWRALVRSGLDPIKERQRQRREAARNLHCLDDIA
FT                   RDAFESRKAELKGDGIAGRWFSPLEIHVLPKLGKVPVVDIDQTDIRDVLAPIWHSKAET
FT                   ARKALNRLAICLKHAAALGLDVDLQATDKARALLGKQRHKIENIPAMPWQDVPGFFASL
FT                   SDGSVTHLALRLLILTGVRSGPLRFLRDEQINGDVWTIPGEAMKGRKGATADFRVPLSD
FT                   AALAVVEQARQHARDGFLFPSLRKGVISDATMSRLMERAGMEARPHGFRSSLRDWIAEA
FT                   TDTPHDIAETTLGHIVGGAVERAYRRTDFLEQRRQLMARWARHVTGQSGQVITLAKRNH
FT                   SEP"
     atggcgcgcc ctctcaacaa actgactgct gttgccgtta agaacgcgtc ggccggtaag        60
     cattcggatg gcggaggact ctggctgcac aagcgcgagg acggcgggtc gcaatggata       120
     ttgcgcgtga acgtccatgg acgacgacgc gaaatggggc ttggttctgc ctcggacgtt       180
     tcgctgaagg aggcccggga agccgctgag cgctggcggg ctctggtgag aagcggtctg       240
     gacccgatca aagagcgcca gcgccagcgg cgagaggcgg cgcgcaacct tcattgtctt       300
     gatgacatcg cgcgtgatgc ttttgagagc cgaaaggccg agctgaaggg cgatggaatt       360
     gcaggccgtt ggttcagtcc gctagaaatc cacgtccttc ctaagctcgg aaaagtgccc       420
     gttgtcgaca ttgatcagac tgacatccgc gacgtgcttg cgcccatctg gcatagcaaa       480
     gcggagaccg cacgaaaggc actaaatcga ctggccatct gcttgaagca cgctgcggct       540
     ctggggctag atgttgactt gcaggcgacg gataaggcgc gcgcgctcct cggcaagcaa       600
     aggcataaaa tcgaaaatat tccggctatg ccttggcagg acgtcccggg ttttttcgct       660
     tccctctcgg atggcagcgt tacccacctc gccctgcgtt tactcatcct gaccggcgtc       720
     aggtctggcc ctcttcgttt cttgcgagat gagcagatca acggcgacgt ttggaccata       780
     cccggtgagg ccatgaaggg tcggaaggga gcaacagccg atttccgcgt tcctctgtcg       840
     gatgctgccc tcgcggtggt agagcaggcc cgccagcacg cacgggatgg gttcctcttc       900
     cccagtctcc ggaaaggcgt gatttccgac gccaccatgt cgcggcttat ggagcgcgct       960
     ggcatggaag ctcgtcctca cggatttcga tcgagcttgc gcgactggat tgccgaggcc      1020
     acagatacgc cccatgacat agcggagaca acgctcggtc acatagtcgg cggtgcggtc      1080
     gaacgagcat accggcggac agacttcctt gagcagcgcc ggcaactgat ggcgcggtgg      1140
     gcgcgccatg taacggggca gagcggtcag gtgattacgt tggcaaagag gaaccacagt      1200
     gaaccgtga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page