(data stored in ACNUC7421 zone)

EMBL: CP001389.PE126

CP001389.PE126       Location/Qualifiers
FT   CDS_pept        138536..139396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23930"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF93"
FT                   /protein_id="ACP23930.1"
FT                   /translation="MNREFDKAMEAWRLPDELSVVDAAILITGNDPSAEHEVYDHKMRR
FT                   AFLEQVTTGHRGFEAAFSALRSAILANKLQARVVFSVDVERAELRAVVRGSRQISELSG
FT                   QLLSHCADAVSLQWEPDWKQTTVEVKELRRWLESRNHRPPFFFPTTETQPEPRPKVRDF
FT                   MDRTHLRYSAKLACAVAAWEALADLPKSKAVKDAICDWVAEHGERYAKPGDRNGFGAAG
FT                   KVTGSALDQIASVVNWKPQGGAPRTGGEVSGKSGQVPNSGVGPARQDQKMQPLDDEGGE
FT                   EPPFL"
     gtgaaccgtg agtttgacaa ggctatggag gcttggaggc ttccggacga actgtcggtc        60
     gtagacgccg cgattttgat aaccggcaac gatccgtccg cggaacatga agtttatgac       120
     cacaaaatgc gtagggcgtt tctggagcag gtcacgaccg gccacagggg ctttgaagcc       180
     gcattcagcg cgctcaggag cgcaattctt gcgaacaagc tccaggcgag ggtggtattc       240
     tcggtcgatg tagagcgggc agaactgaga gcggtggttc gaggcagccg gcaaatatcc       300
     gaactgagcg ggcagcttct gtcgcattgc gcggatgcgg tatccttgca atgggagcca       360
     gactggaaac agaccacggt cgaagtcaag gaactgaggc ggtggctcga gtcacgcaac       420
     caccgcccac cgtttttctt tccgacaact gaaacacagc cagaaccaag accgaaggtg       480
     agggatttca tggatcgaac tcacctccgc tattccgcca agttggcgtg cgcggtggcc       540
     gcatgggaag cgctggctga cctgccaaaa agtaaggcgg tcaaggatgc tatttgcgac       600
     tgggtcgctg agcacggcga gagatacgcg aagcctggcg atagaaacgg tttcggcgcc       660
     gccgggaaag tgaccggaag cgcccttgat caaatagcga gcgtggtgaa ctggaagccg       720
     cagggtggag cgccccgaac agggggggag gtttcaggca aatcaggcca ggttccgaat       780
     agcggcgtcg gcccggcacg acaggatcag aaaatgcagc cgctcgacga cgaggggggt       840
     gaagaacctc ccttcttgta a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page