(data stored in ACNUC7421 zone)

EMBL: CP001389.PE127

CP001389.PE127       Location/Qualifiers
FT   CDS_pept        139552..139749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23931"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF94"
FT                   /protein_id="ACP23931.1"
FT                   /translation="MQLTDPLLTVRESAEVLQISVPTFWRRVADGTVPRPVKIGALSRW
FT                   PYSEIIAVIERAKNSRSDVA"
     atgcaactca cagaccctct cctcaccgta cgcgaaagcg ccgaggtctt gcagatcagc        60
     gtcccgacct tctggcgtcg ggtcgctgac ggaaccgtcc cccggccggt gaaaataggc       120
     gctctctccc gctggcctta ttcggaaatc attgccgtca tcgagcgcgc caagaactcc       180
     cgctccgatg ttgcatag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page