(data stored in ACNUC7421 zone)

EMBL: CP001389.PE128

CP001389.PE128       Location/Qualifiers
FT   CDS_pept        139921..140214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23932"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF95"
FT                   /protein_id="ACP23932.1"
FT                   /translation="MSKVFLTIRRLPDGAPHTMRGRPAWALELLIDAGSAGCTPITDPG
FT                   PRWSSYVHILRKRSGLVIDTLRETHDGQFPGTHARYVLRSPVEVLRSWRDVK"
     atgagcaagg ttttcctaac gatacggcgc ctccccgatg gcgcgcccca tacaatgcgc        60
     ggacggcctg cctgggcgct tgagcttcta atcgacgcgg gaagcgcagg gtgcactcca       120
     atcactgatc cagggcctcg ctggagctcc tacgtgcata tcctgcggaa gaggtcaggg       180
     ctggtaatcg atacgcttcg tgagactcat gacggccaat ttccgggcac gcacgctcgt       240
     tatgtactgc gctcgccagt cgaggtcctc cggagctgga gggatgtcaa atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page