(data stored in ACNUC7421 zone)

EMBL: CP001389.PE129

CP001389.PE129       Location/Qualifiers
FT   CDS_pept        140324..140821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23933"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF96"
FT                   /protein_id="ACP23933.1"
FT                   /translation="MTNINLRDHSHTSGRAEKKPRWLTQFIGHRLEMLLSPAWQDAPRP
FT                   LARLIERLEIEHLRHGGQNNGELYVSYAQFAAYGISKRVICRTLKLGEDLGLIEVIRGE
FT                   GIIRGDIRPENAYRLTFVPAKNRKSPTDEWKQISKARAKDLVTAYRADEKRATNTARRA
FT                   AA"
     atgacaaaca tcaaccttcg tgaccacagc cacacatcgg gccgggcgga aaagaagcca        60
     agatggttga cgcagtttat cgggcatcga ttggaaatgc tgctaagtcc tgcatggcag       120
     gatgcaccac ggcctcttgc tagactgata gagcgactgg aaatcgagca tcttcggcac       180
     ggcgggcaaa acaacggaga gctctacgtt tcatatgcgc agttcgccgc ctacggcata       240
     tcgaagaggg tcatatgcag aacactgaag ctgggcgagg acttgggttt gatagaagtg       300
     attcgtggcg aaggcatcat cagaggcgac attcggcccg agaatgcata ccggctaact       360
     ttcgtgccgg cgaaaaacag aaaatctcca acggacgaat ggaagcaaat ttcgaaagcg       420
     cgtgcaaaag accttgtgac ggcctatcga gcagacgaga agcgggcgac aaacacagcg       480
     cggcgggcgg ctgcatga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page