(data stored in ACNUC7421 zone)

EMBL: CP001389.PE130

CP001389.PE130       Location/Qualifiers
FT   CDS_pept        complement(142074..142328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23934"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF97"
FT                   /protein_id="ACP23934.1"
FT                   /translation="MSVEPEYDPDWDSPEAIAKWRVRGIRNIYERAKEFHRIKAELEME
FT                   ISTARETLVRKPLMREDEIEAATQRAYDALQDRKAKDQS"
     atgtcggtgg agcctgaata cgacccggac tgggatagtc cggaggccat agcgaagtgg        60
     cgtgttcgag gaatcaggaa catctacgaa agagcgaagg agttccaccg cattaaggcg       120
     gaactggaaa tggaaatcag cacggcgcgc gaaactctcg tgcgaaagcc tcttatgcga       180
     gaggacgaaa ttgaggcggc tacacagagg gcgtacgacg ctctacagga tcgcaaggcc       240
     aaggaccaaa gctga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page