(data stored in ACNUC7421 zone)

EMBL: CP001389.PE131

CP001389.PE131       Location/Qualifiers
FT   CDS_pept        complement(142330..142854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23935"
FT                   /db_xref="GOA:C3MF98"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF98"
FT                   /protein_id="ACP23935.1"
FT                   /translation="MNEKLAPFVLVSQPTSLRRHWLVYVSAVFFGLIACAAIQQSWGEG
FT                   LGAILIPAAIGYFVVKGGKSVPGLLVRYSIFMLGFMFVISGLAISEITEAHDGVKTSCL
FT                   TKNDYTAQLTTEKRTQYCQCMSDTLDAAIVWSTSTSFLAFKPLTGKIQDVPELMNLATK
FT                   RANECAVQMGG"
     atgaacgaga agctggcgcc tttcgtgcta gtgagccagc cgacgagcct taggcgtcat        60
     tggcttgttt atgtctcggc ggtctttttc ggcttaatag cctgtgccgc cattcagcaa       120
     agctggggcg agggattggg ggccatcctg attcccgccg ccatcgggta cttcgtcgtg       180
     aagggcggga aaagcgttcc gggtctactt gtacgctatt cgatttttat gctgggtttc       240
     atgttcgtga tttcggggtt ggccatttct gaaatcaccg aagcacatga cggcgtgaag       300
     acttcgtgcc ttacaaaaaa tgactacacc gctcagctaa cgaccgaaaa aagaactcag       360
     tactgccagt gcatgtcgga caccttggat gcagcgattg tatggtctac cagcacatcg       420
     ttcttagcat tcaagccgtt gacgggcaaa attcaggacg ttccagaact gatgaacttg       480
     gcgacaaagc gcgccaatga atgcgccgtg caaatgggag gctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page