(data stored in ACNUC7421 zone)

EMBL: CP001389.PE132

CP001389.PE132       Location/Qualifiers
FT   CDS_pept        143676..147098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01330"
FT                   /product="putative restriction endonuclease type I with R
FT                   subunit / type III with Res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23936"
FT                   /db_xref="GOA:C3MF99"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF99"
FT                   /protein_id="ACP23936.1"
FT                   /translation="MGGALSVNFDHLKSLSPELQRLGTLAERFFADDANTSLIKSRQFG
FT                   EYMVKEIAALSGVYDPAARETTHDLLRRLATQQILPREVADIFHAVRKSGNEATHNLAG
FT                   SPTEALAALKFCRALGVWYRRTYGRDPNFRPGPFVPPKASADIDQATQAELATLRRQVR
FT                   EAEAQLAAAHSSADELAKARAAADELARQAAADNAVWEQTAVEMEANQAELSRKLAELQ
FT                   KAAQAQPQQLQMEFKQAGLQAASRLELDERQTRRLIDAQLVDAGWEADSDRLSYQLGAR
FT                   PEEGRNLAIAEWPAAGGRADYGLFIGLTCVGIIEAKRESVDVPSTLQQAERYARTIALP
FT                   PENSHPGGLWNHGLADPFRVPFVFTTNGRPFVRQWQTKSGIWFCDLRRDTNHPRPLTTW
FT                   FSPKDLLDILATDLDAAAQGLAEDSFGKGRMRPYQEDAIAAIENAVVAGQRDILVSMAT
FT                   GTGKTRTSIALMYRLLKHKRFRRILFLVDRKALGKQTSDALETTEIEGMLNFAQIYKVA
FT                   GLEKKVPEDEDQVQVATVQSLIARILNEPDPAKRPTPGTFDCIIVDEAHRGYTLDAELR
FT                   ESDVGFRNLDDYQSAYRQILDYFDAVKVALTATPALHTREIFGHPVFHYGYRQAVVEGY
FT                   LNDHLPPKRITTALSEAGIHFEGGEEVEIIDRTTGQIDLFELPDEVSLDYDVADFNKRV
FT                   YSEAFNRMVCRAIATEIPPSKPGKTLIFAARDAHADDLVRLLVEELQEEYGNDAVPHGM
FT                   VMKITGNVDKADDLILKFKNDPHPKYVVTVDLLTTGIDVPTICNLVFVRRVKSRILYDQ
FT                   MIGRATRLCPEIGKEHFRIFDAVDLYAELQEMTDMRPVVVKPDISLGQLVTDLDKAETE
FT                   EDKSWVAGQVIVRMRAMANRMDAETRESFERHTGETPENAVQRLATLSGSELQDWLKSH
FT                   PRVIELLERRPIRTGSGNDGVVISTHEDELLRIEEIFGKNTTPEDYITGFERFIRENMN
FT                   QVPALIAVTQRPRDLTRKELSELAGLLDEKNYSEAMLRAAYGKVRNADIAAHIIGFVRQ
FT                   AAIGDPLIPYATRVENAIGKIEASRPWTQKQKEWLRRIGRALKDKPVADPTLLDQGVFA
FT                   DKGGFKRISQEFDGELDDVLHAFNEAIWAPPAA"
     ttgggtgggg cattgtcggt aaatttcgac catctgaaat cgctgagtcc cgaactacag        60
     cgtctgggca cgcttgctga acgcttcttt gcagatgacg ccaatacctc gctgatcaag       120
     agccgtcagt tcggcgaata catggtcaag gagatcgccg cgctctccgg tgtctatgat       180
     cccgctgccc gtgagacgac gcacgatctg cttcggcggc tcgcgaccca gcagatcctg       240
     ccgcgcgagg tggccgacat cttccacgcc gtgcgcaaga gcggcaacga ggcgacccac       300
     aatctggcag ggtcaccgac cgaggcgctg gccgccctca agttctgccg ggcgctgggc       360
     gtctggtatc gccgcaccta cggacgcgat ccgaacttca gaccaggccc cttcgtccct       420
     cccaaggcct ccgccgatat cgatcaggca acgcaggcag aactggccac gcttcgtcgg       480
     caggttcggg aagccgaggc gcagctcgcg gccgcccatt cctcggcgga tgaactcgcc       540
     aaggcccgtg ccgcagccga tgaactcgcc cgccaggctg ccgctgacaa cgcggtctgg       600
     gaacagacgg ccgtcgagat ggaggccaat caggccgagc tttcccgcaa gctcgcggag       660
     ctgcagaagg cggcgcaggc ccagccgcaa caattgcaga tggagttcaa gcaggcaggc       720
     cttcaggccg cgagccggtt ggaactcgac gagcggcaga cccgccgctt gatcgacgcc       780
     caactggtag atgcaggctg ggaggccgac agcgatcgtc tgagttatca actgggcgcg       840
     cgcccggaag aaggccggaa ccttgctatc gccgagtggc cggcagccgg tggacgtgct       900
     gactatgggc tgttcattgg cttgacgtgc gtcggtatca tcgaggcaaa gcgcgagagc       960
     gttgacgtgc cttccacgct ccagcaggcc gagcgctacg cacgcaccat agcgctgccg      1020
     ccggagaaca gccatccggg cggcctatgg aatcatggtc tcgccgaccc gttccgcgtt      1080
     cccttcgtct tcaccacgaa tggccgccct ttcgtccgcc agtggcagac caaatcaggt      1140
     atctggttct gcgatctgcg tcgcgacacg aaccaccccc gacctctgac aacctggttt      1200
     tcgccgaagg atcttctcga catcctcgcg accgatctcg acgccgcagc ccaaggtctc      1260
     gccgaggaca gtttcggcaa gggcaggatg cgaccctacc aagaggacgc aatcgctgcg      1320
     attgagaatg cggtcgtcgc cggccaacgc gatattctcg tgtcgatggc gacagggacg      1380
     ggcaagacgc gcaccagcat cgccctgatg taccgcctgc tgaagcataa gcgcttccgc      1440
     cgtatcctct tcctggtaga tcgaaaggca ctcggcaagc agacaagcga cgccttggaa      1500
     acgaccgaga tcgagggcat gctgaacttc gcccagatct acaaggttgc cgggttggag      1560
     aagaaggttc cggaggacga ggatcaggtg caggtcgcca ccgtccagtc cctgatcgcc      1620
     cgcatcctca acgaacctga cccggccaag cgtccgacgc ctggcacctt cgattgcatt      1680
     atcgtcgatg aagctcatcg cggctacacg ctggacgcag aactacgcga aagcgatgtc      1740
     ggcttccgca atctggatga ctaccagtca gcctatcgcc agatcctcga ttacttcgat      1800
     gccgtgaagg tggcgttgac ggcaacaccc gcgcttcata cccgggagat ctttggccat      1860
     ccggtctttc actatggcta ccgccaagct gtcgtcgaag gttatctcaa cgatcacctg      1920
     ccaccgaagc gaatcaccac agcactctcc gaagccggca tccatttcga gggtggcgag      1980
     gaggtcgaga tcatcgatcg cacgaccggg cagatcgatc tgttcgaact cccggatgaa      2040
     gtttcgctcg actacgacgt cgccgatttc aacaagcggg tctattcgga ggccttcaat      2100
     cgcatggtct gccgggcgat cgctacggaa attccgccaa gcaagccagg caagacgctg      2160
     atcttcgccg cccgcgacgc ccatgcggat gatctcgtcc gtctgctagt cgaggagttg      2220
     caggaggagt atggcaacga cgctgtgccg cacggcatgg tgatgaagat cactggcaat      2280
     gtcgacaagg ctgacgacct gatcctgaag ttcaagaacg atccacatcc gaaatacgtc      2340
     gttaccgtcg atcttctgac cacaggcatt gatgtgccga ccatctgcaa tctggtcttt      2400
     gtgcgcaggg tcaaaagccg cattctctat gaccagatga tcggccgagc cacgcggctt      2460
     tgcccggaga tcggcaagga acatttccgc atcttcgatg ccgtcgatct ctacgccgaa      2520
     ctgcaggaga tgacggacat gcgccccgtc gtcgtcaagc cggatatctc gctcggccag      2580
     cttgtcaccg acctggacaa ggcagagacg gaggaagaca agagttgggt cgcgggccag      2640
     gtgatcgtcc gcatgcgcgc catggcaaac cgcatggatg ctgaaacccg ggagagtttc      2700
     gagcgccaca cgggagagac gccggaaaac gcggtgcagc gtcttgccac cctttccggt      2760
     tccgaactgc aggattggct aaaatcccat ccgcgcgtga tcgaacttct ggagcgccgc      2820
     ccgatccgga ctggaagcgg caacgacggt gtggtcatct ccacccatga agacgagttg      2880
     ctgcgcatcg aggaaatctt tggcaagaac accacgccgg aggattacat caccggcttc      2940
     gagcgcttca tccgggagaa tatgaaccag gtcccggcgc tgattgccgt cacccaacga      3000
     ccgcgtgatc tgacgcgcaa ggaactgtcg gaactggcag gcctgctgga cgagaagaac      3060
     tattccgaag ctatgctgcg cgccgcctat ggcaaggtcc gcaatgccga tatcgccgcc      3120
     catatcatcg gcttcgtccg ccaggcagcg atcggcgatc cgctcatccc ctatgccacg      3180
     cgtgtggaaa acgcgattgg gaagatcgag gcctcgcgcc cctggaccca gaaacagaag      3240
     gaatggctgc gccgcattgg ccgtgcgctg aaggacaagc cggtggccga tccgacgctg      3300
     cttgaccagg gcgtctttgc ggacaagggc ggcttcaagc gcatctccca ggaattcgat      3360
     ggcgagctgg atgatgtcct gcacgccttc aacgaggcga tctgggcgcc gcccgccgcc      3420
     tga                                                                    3423
//

If you have problems or comments...

PBIL Back to PBIL home page