(data stored in ACNUC7421 zone)

EMBL: CP001389.PE134

CP001389.PE134       Location/Qualifiers
FT   CDS_pept        148697..150187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01350"
FT                   /product="putative restriction endonuclease type I, S
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23938"
FT                   /db_xref="GOA:C3MFA1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA1"
FT                   /protein_id="ACP23938.1"
FT                   /translation="MSELPRGWCVTTIQEIADVGTGATPKRGTRAFYESGTIPWITSGA
FT                   VSQRQITYADEFITEAAIRSTNCKVFPTGTILVAMYGEGKTRGSVARLAIDAATNQALA
FT                   AIVLPNDDIVSSEFLMNFLTSQYSQLRGLAAGGVQPNLNLQLIRSTSFPLPPLAEQKRI
FT                   VAKLDALSAKSARARTELARIETLVYRYKQAVLGKAFSGELTVDFRLSRRHLQSEAKAG
FT                   SIHGEEGVERKLKVRGTTDVMKGIQLSPLPESWNWVKNHRLAQNRANAICAGPFGTIFK
FT                   AKDFRDKGIPIIFLRHVAAGEYRTHKPGFMDKKVWQELHQPYSVFGGELLVTKLGDPPG
FT                   VACIFPAGVGTAMVTPDVMKMSVDENASVPKFLMFYFNSPIAKNIIHQLAFGLTRLRVD
FT                   LAMFKTFPVPHPSLEEQLEIVRRIESAFAKIDRLAAEAKRALDLVGKLDEAILAKAFRG
FT                   ELVPQDENDEPAENLLERIRAERAAAPKAKRGRGNAKG"
     atgagtgagt tgccgagggg gtggtgtgtc accacaatcc aagaaatagc cgatgtgggg        60
     actggcgcta caccaaaacg cggaacaaga gcattctacg aatctgggac tatcccatgg       120
     attacaagcg gtgcagtaag ccaaaggcaa attacttacg ctgatgagtt tatcaccgag       180
     gctgctattc gttcgactaa ctgcaaggtc ttcccaaccg gtacaatctt ggttgctatg       240
     tatggagaag gaaagacgcg aggctcggtg gcaaggttgg ccattgacgc ggcaaccaat       300
     caagctcttg cagcgatcgt ccttcccaat gacgacatag tatccagcga attcttgatg       360
     aattttctta cgtctcaata ctcgcagctg cgcggattag cagcgggtgg agttcagccg       420
     aatctaaacc tacaattgat tcgatctacc agtttccccc tcccgcccct ggccgagcaa       480
     aagcgcatcg tggccaagct ggatgcgctg agcgcgaaat ccgcccgcgc ccgcaccgaa       540
     ctcgctcgca tcgaaaccct cgtctaccgc tacaagcagg cggtactcgg caaggcgttc       600
     agcggggagt tgacggtgga tttcagactg agccgtcgtc acctgcagag cgaggccaag       660
     gcaggctcta tccatggaga ggaaggtgtc gaacgaaagc taaaggttag aggaacgacg       720
     gatgtcatga aaggcattca gttatcgcct ctaccggaga gctggaactg ggtcaaaaac       780
     cacaggttag cccagaatcg cgccaacgcg atttgcgccg gacccttcgg tacaattttc       840
     aaagcgaagg actttagaga caaaggcatt ccgatcatat tcctacgcca cgttgctgcc       900
     ggggagtatc gtactcataa gccaggcttc atggacaaga aggtttggca ggaattgcat       960
     cagccttatt cggtgttcgg cggggaactg ctcgtgacga aactgggaga tccgcccggt      1020
     gttgcttgca ttttccctgc tggcgtcggc accgcgatgg tgacgccgga tgtgatgaaa      1080
     atgagcgtcg acgaaaacgc cagcgttcca aagtttctga tgttctattt caactcaccg      1140
     atagccaaga acataattca ccagctcgcc tttggtttga cgcgactgag agttgatttg      1200
     gcaatgttta agacttttcc agtgccacat ccatccctcg aagaacaact cgaaatcgtc      1260
     cgccgcatcg aatccgcctt cgccaaaatc gatcggttgg cggcggaagc taagcgcgcg      1320
     ctggaccttg tgggcaagct ggatgaggcg atcctcgcca aggccttccg cggcgaactg      1380
     gtcccccagg acgaaaacga cgagcccgcc gaaaatcttc tggagcgcat ccgcgccgag      1440
     cgcgcggcgg cgccgaaggc gaagcgtggg cggggtaacg ctaagggcta a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page