(data stored in ACNUC7421 zone)

EMBL: CP001389.PE135

CP001389.PE135       Location/Qualifiers
FT   CDS_pept        150191..151438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23939"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA2"
FT                   /protein_id="ACP23939.1"
FT                   /translation="MSFLREGPITLIARLVRSEALTNDDLVLQKANRVAFEFDAIDARM
FT                   SADEALATIADRADRSRLAVLKILTTAEKFQYLADIGDVRDGQWYRINLLPRGKKPGPF
FT                   AWASSLGDAGYEEIVPFVLDEIRYLFSEVDSPLSPVGAAVGNERALAQAIAEACKFPER
FT                   AIGKSRAARNLLSGANSPHKIVVRDVGQASFCSAIDQHGNELFHLDAGWPISYNKKTAA
FT                   SKPRLKVSDVPVILSHWDWDHLHGYHAIAGLAGGIWIVPVQRLGPGAKLVAEKLATNNR
FT                   LLGVSSANVSAGPLRLGRCKGKAGNLNQTGLCVQTTLQSGKTVLFMGDADYDLVRPRLS
FT                   TLPDFIVATHHGAKFRGSVVSPRGGSGRCVVSVGKGNGYGHPSAAAVMCHSGAGWSMSF
FT                   TCERNGIPRGSRHLGP"
     atgagttttt tgagagaagg gccgattacc ctgatcgcac gattggttcg gtcagaggct        60
     ctcaccaacg acgatttggt cctgcagaag gccaatcgcg tcgctttcga gttcgatgct       120
     attgacgcca ggatgagtgc cgacgaagcg ctggctacca tagcggatag agccgatcgc       180
     tctcgcctgg ctgtgctgaa gattttgacg accgcagaga aatttcaata ccttgcagat       240
     attggggacg ttcgcgatgg tcagtggtat cggatcaact tactgccgcg agggaagaag       300
     ccgggacctt tcgcttgggc gtcttcactc ggagacgctg gttatgaaga aattgtgccc       360
     tttgtcctgg acgaaatccg ttatctgttc tcggaagtcg atagccccct gagcccagtc       420
     ggggcagcag tcggaaatga gcgggctcta gcgcaggcga ttgcagaggc ctgcaagttc       480
     ccagaacggg caatcggtaa aagccgcgcc gcgcgcaatc tccttagcgg tgcgaattcg       540
     cctcacaaaa tcgtcgtccg agatgtcggg caggcgagtt tctgcagcgc aatcgatcag       600
     cacggaaacg aactatttca tctggatgct ggttggccga tctcgtacaa caaaaagacc       660
     gcggctagta aacccaggct aaaagttagc gatgtcccag tgatcctttc tcactgggac       720
     tgggatcatt tgcatggcta tcacgcaata gcgggccttg cgggtggcat ttggattgtc       780
     ccggtgcagc ggcttggacc aggcgcaaag ttggttgctg agaagcttgc caccaataat       840
     cgccttctgg gcgtgagttc cgcaaacgta tcggctggcc ccctgcggct ggggcgctgc       900
     aagggtaaag ccggcaatct caatcagact ggcctatgcg ttcaaactac cttgcaatcg       960
     ggcaagacgg ttcttttcat gggtgatgcc gactacgacc tagtccggcc gagattgtcg      1020
     actctgccgg actttatcgt tgccacccac cacggcgcca aatttagagg aagtgtcgtc      1080
     tcgccacgtg ggggcagtgg ccggtgtgtg gtttcggttg gcaaaggaaa cggctatggc      1140
     catccgtcgg ctgcggctgt tatgtgccac tcgggcgctg gctggtcaat gagcttcacg      1200
     tgcgagcgca atggtattcc gcgcggcagc cgacacttgg gaccctag                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page