(data stored in ACNUC7421 zone)

EMBL: CP001389.PE136

CP001389.PE136       Location/Qualifiers
FT   CDS_pept        151961..154363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23940"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA3"
FT                   /protein_id="ACP23940.1"
FT                   /translation="MTPEEIFEDALVPNTRSVLVLGSFERRVTVYSQQVRALNLVDALL
FT                   SQNVVRDDGKIAIIGGGAAGVTAAVALSKAAPNLKALDLFEARADILQLQKNSTRYLHP
FT                   HFYDWPSIGSDEEDAGLPIMNWTAGPAGDVVRALWNQFDEACRTTRLSFYPNSTVTSLK
FT                   PSSISTVRVVTTGTAISRIYDVVILAIGFGLEAFLDGDTDSYWKPSALAGAMLVQMQEP
FT                   SIFISGNGDGGLVDFQMAAFNALDHRAICQLITNLDLGDALTELRTIEVEAWAPGANVN
FT                   LMDAYRMRVKPLIPAPAWATVVEALRNNVRIRLHTNEAQLLRKTTALHNRLATFLIIEA
FT                   DRDIERNAITVTTGVGFTDGVVPATGPISLDGEAPFTPYRRFLRLGPDSAPNLAPFDAL
FT                   LATYPGRLLPKASATRPESPTLTASARARFARFAPAAAPAQLPEQAAVGPRILRIVLQR
FT                   QGSNITWSGDLAPTDIDTLWRGNDGLSVYVDVAAADSDGLIAALARLGCHAASFHLYAR
FT                   DAQGWRTSMTSLCASRSLPGPDMGTRCIVNDWEDPPAVAQRATSPIADLTRIVSDRLDL
FT                   ETLSQLHGALYDVLGPPNVEIGWLIEARLKGQLWARWLNWHPVLQAESATRRRFMLLLV
FT                   TEQDHDNITPELLVRVGPRSLRPFLTKPTIFGLTFAVCSEHAVSPIAVAPGNMAGGGLT
FT                   GHACGVGWIQGRDLSAGFAAAQAWTTGVVLLAQLREAFRLAERDVRFDHAPGDQAKVGD
FT                   VLLDQEPLVIPADELFVIALEAGEQSMQQHLRSVIQWRATTNRASLE"
     gtgacacccg aagagatttt cgaagatgcg ttggtcccta acacaaggag cgtgctcgta        60
     cttgggagct tcgaacgcag agtcacggtc tactcccagc aggtacgtgc gctcaatctc       120
     gtcgatgctt tactctcaca gaatgtagtt cgtgacgacg gcaaaatcgc tatcatcggc       180
     ggaggtgctg caggagtaac cgcggccgta gccttatcca aggcggcccc taacctgaag       240
     gcgctcgacc tattcgaggc gcgagcggac attctgcagc ttcagaaaaa cagcacgcgc       300
     tatcttcacc ctcactttta tgactggcca agcatcggct cggacgaaga agatgcaggc       360
     ttgccgatta tgaattggac ggccggcccg gcgggcgacg ttgtaagggc cctttggaac       420
     caatttgacg aggcatgcag aacaacgaga ttgagctttt atccgaactc gaccgttact       480
     tcgctgaagc caagctcaat aagcacagtt cgcgtggtaa cgactgggac tgctatttcg       540
     agaatatatg atgtcgttat cctagctatt ggcttcggac ttgaagcgtt cttagacggc       600
     gacaccgact catattggaa gcccagcgcg ctggcaggcg ccatgctcgt gcagatgcaa       660
     gagcccagca tcttcatttc cggcaacggc gatggtggtc tcgtcgactt tcagatggcg       720
     gccttcaatg cgcttgatca ccgcgcgata tgccagctca tcacaaatct tgatcttggc       780
     gacgcattga cggagctccg cacaattgag gttgaggcct gggcgccggg cgcgaacgtc       840
     aatctcatgg atgcgtaccg gatgagggta aagcccctga tcccagcccc agcctgggcc       900
     acggtcgtcg aagcgctgag aaacaatgta cgcattcgtt tacacacaaa tgaggcacag       960
     ctcctccgca agacaaccgc tctgcacaat cgtctcgcaa ctttcctcat aatcgaggcc      1020
     gaccgagaca ttgaacgcaa tgctatcaca gtcacgaccg gcgttggctt cacggatggc      1080
     gtggtaccgg cgaccgggcc catctctctc gatggggaag ccccctttac gccatatcgg      1140
     cgcttccttc gacttggccc cgacagtgcc ccgaacctcg cgccattcga tgccctgctt      1200
     gccacgtatc ctggacgact tttgccaaag gcttctgcca ctagacccga atctccgacc      1260
     ctaaccgcct ctgcaagagc acgtttcgcg cgttttgcgc cagccgcggc gccagcgcag      1320
     cttccagaac aggcagcggt tgggcctcgg atcttacgca ttgtcttgca gcgccagggg      1380
     agcaacataa cttggtcagg cgacctggct cctaccgaca ttgacacgct atggcgcgga      1440
     aacgacggcc tgtccgttta tgtagatgta gcggctgccg attccgacgg tctgatcgcg      1500
     gccctagctc gcctgggatg tcacgcggcc agttttcatc tgtatgcccg ggacgctcag      1560
     ggatggcgaa cgtccatgac atcgctttgt gctagccgtt cgcttcccgg gcccgatatg      1620
     ggcacccgct gcatcgtcaa tgactgggaa gacccgcctg cagtggcgca acgggcgacg      1680
     tctccgatag ccgatcttac tcgcattgtt tccgatagat tggacttaga aaccctaagt      1740
     caacttcatg gcgcactgta tgatgtactg ggtccgccga acgtggaaat cggatggctg      1800
     atcgaggcac gccttaaagg gcagttgtgg gcccggtggt taaattggca ccccgtcctg      1860
     caagccgaat ctgcaacgcg tcggcgtttc atgctgctgt tagtcacaga acaagaccat      1920
     gacaatatta ctccggagtt gctcgtcaga gtcgggccac gcagcctacg gccgtttctg      1980
     accaagccaa cgattttcgg acttactttt gctgtctgct cagagcacgc agtgagcccg      2040
     attgctgttg ctcccggcaa catggctggg ggtggattga ccggtcatgc ttgtggcgtt      2100
     ggttggattc agggtcgcga tctgtccgca ggatttgcgg cagcccaagc ctggacaacc      2160
     ggtgtggtgc tgctcgcgca attgagagag gcatttcgac ttgccgaaag agatgtcagg      2220
     ttcgaccatg cacctggcga tcaagcgaaa gtgggtgacg tgctgctaga tcaagagccg      2280
     ttagttatcc ccgcggacga gctttttgtt atcgcgctag aggcgggcga gcagagtatg      2340
     cagcagcacc ttcgatcggt gatccaatgg cgcgccacca ccaatcgagc tagcttggag      2400
     tag                                                                    2403
//

If you have problems or comments...

PBIL Back to PBIL home page