(data stored in ACNUC7421 zone)

EMBL: CP001389.PE139

CP001389.PE139       Location/Qualifiers
FT   CDS_pept        159776..160948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01410"
FT                   /product="possible BirS-like protein incolved in biotin
FT                   regulatory network"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23943"
FT                   /db_xref="GOA:C3MFA6"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA6"
FT                   /protein_id="ACP23943.1"
FT                   /translation="MSGLETAIRNALERSERSNAEVRARIYQSARQALENGLKKQEIED
FT                   PDIIAKQRHRLEAVIHAIETEERAALKARVASPVVSLAEVKAKGDAAGSAPAGAAAAAR
FT                   QEPGFQAEARAASTADGGLGALGALRPERDGPMAAAQPVTDGEKTVGAARSGSIAPDLG
FT                   VADKRPRKRRRGRLLSFFMVVATLAAAVGAGVWWVETNDLLKSPAERDTNVANPPAVVE
FT                   SEDFPGAAGLPTLGAQEGFSGDWIEVFTSADVSAVKPGTRASAEPFDDDGGERIRLTSA
FT                   AGAKEGEVAIDIPADVLAKLSGKSSTLALSVQALPGKTTEFSVECDFAALGACGRHRFT
FT                   AHDERVDMLFKMSFEDGRAPGSSGRLLINSDVSGAGNSLDLFAIRVLPGQ"
     gtgagcggac tcgagacggc gatcaggaat gcactggaac gctcggagcg gagcaatgcg        60
     gaagtccgcg cgcggatcta tcagtcggcc cgccaggcgt tggaaaacgg cctgaagaag       120
     caggaaatcg aggacccgga catcatcgcc aagcagcgcc accggctgga ggcggtcatt       180
     cacgccatcg aaacggagga gcgcgcggcc ttgaaggcgc gcgtcgcctc cccggtcgtg       240
     agcctcgcgg aagtgaaggc caagggcgat gccgccggct cggcgcctgc cggcgcggcc       300
     gccgcggcgc ggcaggagcc gggcttccag gcggaggcgc gggcggcgtc gaccgcggac       360
     ggcggtctcg gggcgcttgg cgccctgcgc cctgagcgcg acggccctat ggctgcagca       420
     cagcccgtga ccgatggcga aaaaaccgtc ggcgcggcaa ggtccggctc gatcgcgccg       480
     gatctgggtg ttgccgacaa gcgtccccgc aagcgccggc gcggtcggct tctctctttt       540
     ttcatggtcg tcgccacgct tgccgcggca gtgggggccg gtgtctggtg ggtggagacc       600
     aacgatctgt tgaagtcgcc cgccgagcgc gacactaatg tcgccaatcc gccggccgtc       660
     gtggagagcg aggacttccc cggcgcagcc gggttgccga cgctgggtgc gcaggagggt       720
     ttctccggcg attggatcga ggttttcaca tccgcggatg tttcggccgt caagcccggc       780
     acccgtgcca gcgcagagcc tttcgatgac gatggcggtg aacgcatccg cctgacgtcg       840
     gcagcggggg cgaaggaagg cgaggtggcg atcgacattc ccgccgatgt gcttgccaag       900
     ctctcgggca agtcctcgac gctggcgctg agcgtccagg cgcttccggg caagacgacg       960
     gagttctccg tcgagtgcga tttcgcggcg ctcggcgcct gcggccggca tcgcttcacc      1020
     gcccatgacg agcgcgtcga catgctgttc aagatgagct tcgaagatgg tcgggcgccg      1080
     ggcagttccg ggagactgct gatcaacagc gacgtcagcg gcgccggcaa cagcctggat      1140
     ctcttcgcca tccgcgtcct gccgggacaa tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page