(data stored in ACNUC7421 zone)

EMBL: CP001389.PE140

CP001389.PE140       Location/Qualifiers
FT   CDS_pept        complement(161207..162109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01420"
FT                   /product="conserved hypothetical protein contains a
FT                   predicted polyphosphate kinase 2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23944"
FT                   /db_xref="GOA:C3MFA7"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA7"
FT                   /protein_id="ACP23944.1"
FT                   /translation="MALEQSPTGGAPGSRAVELAIGGKTRVFDIDNPELPKWIDDDAFS
FT                   SDDYPYEKKLSEEEYEETLTKLQIELVKVQFWMQATGKRVMAVFEGRDAAGKGGAIHAT
FT                   MAYMNPRSARVVALTKPTETERGQWYFQRYVSTFPTAGEFVLFDRSWYNRAGVEPVMGF
FT                   CTPEQYEHFLKETPRFEKMIVNENIQLFKFWLNIGREMQLKRFHDRRHDPLKIWKLSPM
FT                   DIAALPKWNDYTEKRDRMLKETHTDHAPWTVIRGNDKRRARINLIRHMLTKLDYDGKDK
FT                   AAIGKVDDKIVGAGPGFLR"
     atggccctcg aacagtcacc aactggcggc gcgccgggaa gccgggcggt cgagcttgcg        60
     atcggcggca agacccgggt gttcgacatc gacaatccgg agctgccgaa atggatcgac       120
     gacgacgcct tttcttccga tgactatccc tacgagaaga agctcagcga agaggaatac       180
     gaggaaacgc tgacgaagct gcagatcgag ctcgtcaagg tgcagttctg gatgcaggcg       240
     accggcaagc gcgtgatggc cgtcttcgag gggcgcgatg cggccggcaa gggcggcgcc       300
     atccatgcga cgatggccta tatgaacccc cgttccgccc gcgtcgtggc acttaccaag       360
     cccaccgaga ccgagcgcgg ccagtggtat ttccagcgct atgtctcgac ctttccgacg       420
     gccggcgaat tcgttctctt cgaccgttcc tggtacaacc gcgccggcgt cgagccagtg       480
     atgggcttct gcacgccgga gcaatacgag cattttctca aggagacgcc gcgcttcgaa       540
     aagatgatcg tcaacgagaa catccagctc ttcaagttct ggctcaatat cggccgggag       600
     atgcaattga agcggttcca cgaccgtcgg catgatccgt tgaagatctg gaaactgtcg       660
     ccgatggaca tcgcggcgct gcccaagtgg aacgactaca ccgagaagcg cgaccggatg       720
     ctgaaggaaa cgcatacgga ccatgcaccc tggacagtca tccgcggcaa tgacaaacgc       780
     cgcgcccgga tcaacctgat ccgtcacatg ctgacgaagc tcgactacga cggtaaggac       840
     aaggcggcga tcggcaaggt agacgacaag atcgtcggcg ccggacccgg ctttctcagg       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page