(data stored in ACNUC7421 zone)

EMBL: CP001389.PE144

CP001389.PE144       Location/Qualifiers
FT   CDS_pept        166403..167725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01460"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23948"
FT                   /db_xref="GOA:C3MFB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB1"
FT                   /protein_id="ACP23948.1"
FT                   /translation="MTDVASPMVRVSTRPAESRRDIGIKRRYAAERRFRAYGISAIAIG
FT                   LFFLAVLLWSVASKGYTAFQQTTITLPIEFSEKVIDPKNERATDPKQLMTANYPVLVRD
FT                   ALVKQLGIDPKKRPLVKQATDMVSDSVRTQLRDIVTGDPSVIGKTIPVTLLADANIDSA
FT                   FKGQIDLSVEESKRKVKDQQVTWMNELAEAGVLKKSFNTGIFSFGASSRPEAAGVGVAL
FT                   VGSAYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYGLLGLA
FT                   VFVNFAGMPRSAALVGGFVLTLMTLPTIIIATRAALKAVPPSIRSAALGLGASKMQTIF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDYPGSPLEPSTALPVQIYMW
FT                   ANEAERAFVERTSGAIIILLIFLIIMNLGAILLRRRFERRW"
     atgaccgacg tagcttctcc catggtaagg gtctcgaccc gtcctgccga aagccgccgc        60
     gacatcggca tcaagcgccg ctacgccgcc gagcgccggt tccgcgccta tggcatcagc       120
     gccattgcca tcggcctgtt cttccttgcg gtccttctct ggagcgtcgc ttcgaaaggc       180
     tacacggcct tccagcaaac gacgatcacg ttgccgatcg agttttcgga gaaggtgatc       240
     gacccgaaga acgagcgggc gaccgatccg aagcagctga tgaccgccaa ctatccggtc       300
     ctcgttcgcg acgcgctggt caagcagctt ggcatcgacc cgaagaagcg gccgctggtc       360
     aagcaggcga ccgacatggt ctccgacagc gtccgcaccc agctgcgcga catcgtcact       420
     ggcgatcctt cggtcatcgg caagacgatc ccggtaacct tgctcgccga cgcgaacatc       480
     gactcggctt tcaaggggca gatcgacctt tcggtcgaag aatcgaagcg caaggtcaag       540
     gaccagcagg tcacctggat gaacgagctg gccgaggccg gcgtcctgaa gaagagcttc       600
     aacaccggca tcttcagctt cggcgcctcc agccgcccgg aagccgccgg cgttggcgtg       660
     gcgctcgtcg gatccgccta tatgatgctg atcgttctgg tcctgtcgct gccgatcggc       720
     gtcgccgcct cgatctatct cgaggaattt gcgccgaaga accgcctgac cgacctgatc       780
     gaggtcaaca tcaacaatct cgccgccgtg ccgtcgatcg tctacggtct gctcggcctg       840
     gcggtcttcg tgaacttcgc cggcatgccg cgttcggcgg cactcgtcgg cggtttcgtg       900
     ctgacgctga tgacgctgcc gacgatcatt atcgcgacgc gcgccgcgct gaaggctgtg       960
     ccgccatcga tccgctcggc cgcgctcggc ctcggcgcct cgaagatgca gacgatcttc      1020
     caccatgtgc tgccgcttgc catgcccggc attttgaccg gcacgatcat cggcctggcg      1080
     cacgccctcg gcgagacggc cccgctgctg ctgatcggca tggtcgcctt cgtcgtcgac      1140
     tatccgggct cgccgctcga gccgtccacg gcgcttcccg tgcagatcta catgtgggcg      1200
     aacgaggcgg agcgtgcctt cgtggagcga acctcggggg cgatcatcat cctcttgatc      1260
     ttcctcatca tcatgaacct cggggcaatt ctgttgcggc gccgctttga gcgtcgctgg      1320
     tag                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page