(data stored in ACNUC7421 zone)

EMBL: CP001389.PE145

CP001389.PE145       Location/Qualifiers
FT   CDS_pept        167738..168553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01470"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23949"
FT                   /db_xref="GOA:C3MFB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB2"
FT                   /protein_id="ACP23949.1"
FT                   /translation="MNIMSEAAVEKALDQKMNTVPLKMIGKDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRTLNRMNDTIENCRVTGRITLDEDDIYDPSIDVVELRA
FT                   RVGMVFQKPNPFPKSIYENVSYGPRIHGLARTKADFDEIVETSLQKAGLWNEVKDRLQE
FT                   PGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRANFTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDQRTQDYIMGRFG"
     atgaacatca tgtcggaagc tgcagtcgaa aaggctctgg accagaaaat gaatacggtg        60
     cccttgaaga tgatcggcaa ggatgtgtcg gtctattacg gcgagaagcg cgcgcttttc       120
     gacgtcaacc tgaatatccg cgagaacacg gtgacggcgc tgatcggtcc gtccggctgc       180
     ggcaagtcga ccttcctgcg tacgctcaac cgcatgaacg acacgatcga gaattgccgc       240
     gtcaccggcc ggatcaccct cgacgaggac gacatctacg atccgtcgat cgacgtggtg       300
     gaactgcgcg cccgtgtcgg catggtgttc cagaagccca atccgttccc gaagtcgatc       360
     tacgagaacg tctcctacgg gccgcgcatc catggcctcg cccgcaccaa ggccgatttc       420
     gacgagatcg tcgaaacgag cctgcagaag gccggcctgt ggaacgaggt gaaggatcgt       480
     ctgcaggagc cggggacggg tctttccggc ggccagcagc agcgcctctg catcgcccgt       540
     gccgtcgccg tcagcccgga agtgatcctg atggacgagc cctgctcggc ccttgacccg       600
     attgccaccg ccaaggtcga agagcttatt cacgagctgc gcgccaattt caccatcgtc       660
     atcgtcaccc attcgatgca gcaggccgcc cgcgtttcgc agcgcaccgc catgttccac       720
     ctcggcaatc tcgtcgagga gaacgatacc gacaagatgt tcaccaatcc ggacgaccag       780
     cgcacgcagg attacatcat gggccgcttc ggctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page