(data stored in ACNUC7421 zone)

EMBL: CP001389.PE148

CP001389.PE148       Location/Qualifiers
FT   CDS_pept        complement(170132..170650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23952"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB5"
FT                   /protein_id="ACP23952.1"
FT                   /translation="MNWTDERVEKLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLSL
FT                   PGRAKAGGTTAAARPKRATSAPRAPNYAARAVTRTVTRTAGATVLKEEVAVDLVAEQDL
FT                   VLDTNIVVPMSRRLELTQLTERTCKWPIGDPLKEEFHFCGNDSPESSPYCSYHARLAYQ
FT                   PSAERRRMR"
     atgaactgga ctgacgagcg ggttgaaaag ctgaagaagc tttggtcgga gggtctgagc        60
     gcgagtcaga tcgcggcgca gctgggaggc gtcagtcgca acgcggtcat cggcaaggtt       120
     catcgcttga gcctgcccgg ccgcgccaag gctggcggaa cgaccgcggc ggctcgtccc       180
     aagcgggcga cttcggcgcc gcgtgccccg aactacgccg cacgcgccgt gacccggacc       240
     gtcacccgca cggccggcgc gaccgtgctc aaggaagagg tcgccgtcga tctggtggcg       300
     gaacaggatc tcgtcctcga tacgaacatc gtcgtgccga tgtcgcgccg gctcgagctc       360
     acccagctga ccgagcgaac ctgcaaatgg ccgatcggcg atccgctcaa ggaagaattc       420
     cacttctgcg gcaacgactc gccggaatcc tcgccctatt gcagctacca cgcccggctc       480
     gcctaccagc cctcggccga gcggcggcgc atgcgctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page