(data stored in ACNUC7421 zone)

EMBL: CP001389.PE156

CP001389.PE156       Location/Qualifiers
FT   CDS_pept        178722..179573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01600"
FT                   /product="predicted extracellular amino acid solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23960"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC3"
FT                   /protein_id="ACP23960.1"
FT                   /translation="MTRVFFHRLFGMLAVTVALLASGAGAAPNDLPLLFDARERIAKPD
FT                   LTALARLRFLTTVDFPPFNFIDQSGKLSGFHVDLAREICRELEIESKCQIQAVTYPELM
FT                   PALEQGQGEAIVAGIAVTPELRRRFAFSRAFMQMPARFALNRKAAEGVKSPADLVGKPI
FT                   GAVAGTTHEAMLKAFFPQLEAKAYPDRDALLNALREGAVTAAFSDAMQLSFWVSGSVAA
FT                   GCCTLLDGAYFSERFLGEGLTIMNRTTEPALTQAIDHALLALSRSGRLEEIYLRYFPNG
FT                   IY"
     atgacgcgcg ttttctttca tcgtcttttc ggaatgcttg ctgtcacagt ggcgcttctc        60
     gcgtccgggg cgggcgccgc accgaacgac ctgcctctgc tgttcgatgc ccgcgagcgc       120
     atcgccaagc ctgatctgac cgcgctggcg cggttgcggt tcctcacgac ggtcgatttc       180
     ccgccgttca atttcatcga ccagtcgggc aagctttccg gctttcacgt cgaccttgcc       240
     cgggaaatct gccgcgaact tgagatcgag tcgaaatgcc agatccaggc ggtaacctat       300
     cccgagctga tgccggccct tgaacagggc cagggcgagg cgatcgtcgc cggcatcgcc       360
     gtgacgccgg aactgcggcg gcgtttcgcc ttctccaggg ccttcatgca aatgccggca       420
     cgcttcgccc tcaacaggaa ggcggccgag ggcgtcaaga gcccggccga tctcgtcggc       480
     aagcccatcg gggcggtcgc cgggacgacg catgaggcga tgctgaaagc cttctttccg       540
     cagctcgaag ccaaggccta tcccgatcgc gatgccttgc tgaacgcctt gcgggagggc       600
     gccgtgacgg ccgccttctc cgatgccatg cagctttcct tctgggtctc cggcagcgtc       660
     gccgcaggat gctgcacttt gctggacggc gcctatttct ctgagcgctt cctgggcgag       720
     ggcctgacga tcatgaaccg cacgaccgag cctgccttga cccaggcgat cgaccacgcg       780
     ctgctggcgc tgtcacgcag cggcaggctg gaggagatct acctgcgcta ttttccgaac       840
     ggcatctatt ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page