(data stored in ACNUC7421 zone)

EMBL: CP001389.PE157

CP001389.PE157       Location/Qualifiers
FT   CDS_pept        complement(179598..180008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23961"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC4"
FT                   /protein_id="ACP23961.1"
FT                   /translation="MSASFSQHEALVYVMVMMSAVDRSMSDDEFARIGGLVRFLPAFDG
FT                   FDEDRLVHIGRECAAQLAAPEGLDVTLEMVRESLPQRHYETAYALAVEIAAADQRIRTE
FT                   EIRLLQLLRDRLALDKLTCAAIERGALARFRR"
     atgtccgcaa gcttcagcca gcacgaagcc ctcgtctatg tcatggtcat gatgtcggcc        60
     gtggacagaa gcatgagcga tgacgaattc gcgcggatcg gcgggctcgt gcgtttcctg       120
     ccggccttcg acggtttcga cgaggaccgg ctggtccata tcggccgcga atgcgcggcc       180
     cagcttgccg ctcccgaggg gctcgacgtc accctcgaaa tggttcgcga atcgctgccg       240
     cagcggcact acgaaaccgc ctatgcactt gccgtcgaga tcgccgccgc cgaccagcgc       300
     atccgcaccg aggaaatccg gctgctgcag ctgttgcgcg accggctcgc cctcgacaag       360
     ctcacctgcg cggcgatcga acgcggcgcc ctcgcccgct tccgcaggta g                411
//

If you have problems or comments...

PBIL Back to PBIL home page