(data stored in ACNUC7421 zone)

EMBL: CP001389.PE158

CP001389.PE158       Location/Qualifiers
FT   CDS_pept        complement(180057..180866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23962"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC5"
FT                   /protein_id="ACP23962.1"
FT                   /translation="MRPQVISIVGGLAALALYAAILLGGAATIRGRESAATPDFVLETP
FT                   DAAAIDEPAEEPVPAAEPPAEPAPPPAEAAAKTSRTPVRPVDPNLFAIPEEGVAKPLER
FT                   IAPRPPFSAPPEKKAVPLVLQRPVALAAGLVQNGDTTLQIKDIEPEKAEKVCEGAGKSW
FT                   PCGMVARTAFRNFLRGRALVCDQIDEKAEGSPAVSCKVGNMNVAEWLVTNGWATPLPGT
FT                   PLEAKAEDARNAKRGFYGDDPRDLRRRPAVIEEPAAGTDFGEPAPDL"
     atgcggccgc aggtcatctc catcgtcggc gggctcgccg ccctcgccct ctacgccgcc        60
     atcctgctcg gcggggccgc tacgatccgc ggccgcgaga gcgccgccac gcccgatttc       120
     gtgctcgaga cgccggacgc tgccgcgatc gacgagccgg ccgaagagcc agttccggcg       180
     gcggagcctc cagccgagcc ggcgccgccg cccgccgagg cggccgccaa gacctccagg       240
     acgccggtgc ggccggtcga ccccaatctt ttcgccatcc cggaagaagg tgttgccaaa       300
     ccgcttgaac ggatcgcgcc gcggccgccc ttctccgcac cgcccgaaaa gaaggcggtg       360
     cccctcgtct tgcaacgacc cgtcgccctt gccgccggcc tcgtccagaa cggcgacacg       420
     acgctgcaga tcaaggacat agagccggag aaggcggaga aggtttgcga gggagccggc       480
     aagagttggc cctgcggcat ggtcgcgcgc accgcattcc gcaatttcct gagggggcga       540
     gcactcgtct gcgaccagat cgacgagaag gccgaaggct cccccgccgt aagctgcaag       600
     gtcggcaaca tgaacgtcgc cgaatggctg gtcacgaacg gctgggccac tcccctgccc       660
     ggcacgccgc tcgaagcgaa agccgaagac gcgcgaaacg ccaagcgcgg tttctacggc       720
     gatgacccgc gtgacttgcg ccgcaggcct gcggtgatcg aggagcccgc cgccggcacg       780
     gacttcggcg agcccgcgcc ggacttgtaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page