(data stored in ACNUC7421 zone)

EMBL: CP001389.PE16

CP001389.PE16        Location/Qualifiers
FT   CDS_pept        complement(14101..14673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00160"
FT                   /product="ribosomal protein S30Ae/sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23820"
FT                   /db_xref="GOA:C3MEJ7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ7"
FT                   /protein_id="ACP23820.1"
FT                   /translation="MSVRVSGKHMEIGESFRSRIGEQIREAVAKYFDGGYSSQVTVEKS
FT                   GSRFSADCKLHLDTGVVLQANGQANEPQAAFDAASDRIEKRLRRYKRKLKDHHNGNGQN
FT                   AAEVAYRVMDSVPFEDEEVPDDYAPTIVAESTKQLRTMSVANAVMALDMTDEPVLMFRS
FT                   PGKDDLNIVYRRNDGNIGWIDAANIKG"
     atgagtgtgc gtgtatccgg taaacatatg gaaatcggtg aatcgtttcg ctcgcgcata        60
     ggcgagcaga ttcgtgaggc cgtagccaaa tatttcgacg gaggatattc aagccaggtc       120
     actgtggaaa agtccggctc gcgcttcagc gccgactgca agcttcatct cgatacgggc       180
     gtggtcttgc aggcgaacgg tcaggcgaac gagccacagg cggccttcga cgcggcctcg       240
     gaccgcatcg agaagcggct tcgccgctac aaacgcaagc tcaaggacca tcacaacggc       300
     aacggtcaga acgccgccga ggtggcctac agggtaatgg actcggttcc cttcgaggac       360
     gaggaagttc ccgatgatta tgcaccgacc atcgttgccg aaagcacgaa acaactaagg       420
     actatgtccg tcgccaacgc cgtcatggct ctcgacatga ccgacgaacc ggtgctgatg       480
     ttccgcagcc ccggcaagga cgatctgaac atcgtctacc ggcgcaacga tggaaatatt       540
     ggctggatcg acgccgccaa tatcaaagga tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page