(data stored in ACNUC7421 zone)

EMBL: CP001389.PE160

CP001389.PE160       Location/Qualifiers
FT   CDS_pept        complement(181691..182215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01640"
FT                   /product="putative transcriptional regulator protein, HxlR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23964"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC7"
FT                   /protein_id="ACP23964.1"
FT                   /translation="MTDDHRSACPINLSLEVFGDKWSLLIIRDMIFGGKRHFRELLRSQ
FT                   EGISSNILADRLKTLLEIGMLTKRDDPSHKQKAIYSLTEMAIALVPIMAHLGAWGRRYL
FT                   PVSEELSIRAQLMEEGGPVLWERFMDELRAEHLGVSRVSEGPSVRQTLQAAYEEVIARK
FT                   ATEREPANAGS"
     atgactgacg atcaccgctc tgcctgcccg atcaatctct cgctcgaagt cttcggcgac        60
     aaatggagcc tcctgatcat ccgcgacatg atcttcggtg gcaaacgcca tttccgcgag       120
     ctcttgcgat cacaggaggg catttcttcc aacatcctcg ccgaccggct gaagacgctg       180
     ctcgaaatcg gcatgctgac caagcgcgac gatccgagcc acaagcagaa ggcgatctac       240
     agcctgaccg agatggcgat cgcgctggtg ccgatcatgg cgcatcttgg cgcctggggc       300
     cgacgctatc tgccggtcag cgaggaactg agcatccgcg cccagctcat ggaggagggc       360
     ggcccggttc tttgggaacg cttcatggac gagctcaggg ccgaacatct cggcgtgtct       420
     cgtgtatcgg agggcccatc cgtgcgccag acgctgcagg cggcctatga ggaggtcata       480
     gcccgcaagg ccacggaacg ggaacccgcc aacgccggtt catga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page