(data stored in ACNUC7421 zone)

EMBL: CP001389.PE161

CP001389.PE161       Location/Qualifiers
FT   CDS_pept        complement(182367..182945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01650"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23965"
FT                   /db_xref="GOA:C3MFC8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC8"
FT                   /protein_id="ACP23965.1"
FT                   /translation="MQPLPFALAILLLLATPGPTNTLLWLSGAAAGMRRSLPLLAGELG
FT                   GYLTVIVPVTVLAAPLISAHPAVGLLLKLAAAGWILFMAHALWTMKAQGASDRPIAPGQ
FT                   VFVTTLLNPKALIIALVIMPQVGLQAMLPWLLGFAMLTLGAGSLWIAAGTLLARLPRPV
FT                   APRLPRRIAAVCLVAFSFGIAGSALASMI"
     atgcagccgc tccccttcgc ccttgccatc ctgcttctgc tcgcgacgcc cgggccgacc        60
     aatacgctgt tgtggctttc cggtgcggcg gccggcatgc gacgctcctt gccgctgctt       120
     gccggcgaac tcggcggcta tctgacggtg atcgtcccgg tgacggtgct ggcggcgccg       180
     ctcatttccg cgcatccggc tgtcggcctc ctgctgaagc tcgccgccgc cggctggatc       240
     ctcttcatgg cgcatgccct ctggacgatg aaggcgcagg gcgcaagcga tcggccgatc       300
     gcccccggac aggtgttcgt taccactctc ctcaacccga aggcgctgat cattgcgctc       360
     gtcatcatgc cgcaggttgg gcttcaagcg atgctgccat ggcttctcgg gtttgcgatg       420
     ctgacgcttg gtgccggttc gctgtggatt gccgccggca ctctcctggc gcgtttgccg       480
     cggccggtcg ccccgcgcct gccccgccgc atcgccgcag tctgcctcgt cgccttttcc       540
     ttcgggatcg ccggcagcgc gcttgcgtcg atgatctga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page