(data stored in ACNUC7421 zone)

EMBL: CP001389.PE162

CP001389.PE162       Location/Qualifiers
FT   CDS_pept        complement(183275..183637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23966"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC9"
FT                   /protein_id="ACP23966.1"
FT                   /translation="MPTRCRFPPRSTVLGMRTGGTTMSKSNRITVENIIHPGKTTSVDA
FT                   DKYAAMKTALLAVIPVQAPGLTLAEVRERIFAHLPEERFPGGKGVSWWSKAVQLDLEAR
FT                   GEIVREKTRPIRLHRS"
     atgccaacgc gttgtcggtt cccaccccgc tcgaccgtcc ttgggatgcg aactggagga        60
     acaaccatgt cgaagtccaa ccggatcacc gtcgagaaca tcatccaccc cggcaagacc       120
     acttcggtcg acgccgataa gtatgcggcg atgaagaccg ccctgctcgc ggtgatcccc       180
     gtgcaagcgc ccgggctgac gctggccgaa gttcgcgagc gcatcttcgc ccatctgccg       240
     gaagagcggt ttccgggcgg caagggcgtc tcctggtggt cgaaagccgt gcaactcgac       300
     ctcgaggcaa ggggagagat cgtgcgggag aagacgcggc cgatccggct gcacaggagc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page