(data stored in ACNUC7421 zone)

EMBL: CP001389.PE165

CP001389.PE165       Location/Qualifiers
FT   CDS_pept        complement(187532..189328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01690"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23969"
FT                   /db_xref="GOA:C3MFR8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR8"
FT                   /protein_id="ACP23969.1"
FT                   /translation="MPIYKAPVDDTLFILNDVLGLERYHNLPGFADATPDMVAAILGEA
FT                   ARLAEEELFPINLSGDQEGCKRNDDGSVTTPAGFKQAFDLYREGGWLGLAAPEEFGGQG
FT                   LPYTLHTAVGEFLSAANMSLMMYPGLTQGAIAAILVHGSEEQKRAYLPKMVDGTWTGTM
FT                   NLTEPHCGTDLGLLRTKAIPNGDGSYRISGQKIFISAGEHDMAENIIHLVLARIEGAPE
FT                   GVKGISLFIVPKFKLNDDGEPGARNGVSCGAIEHKMGIHGNSTCVMNYDEATGYLIGAE
FT                   NKGLNAMFVMMNEARLAVGMQGLAIAEIAYQNAANYARERLQGRSLSGVKAPEQKADPI
FT                   IVHPDVRRSLMTIKAFNEAGRAFTLWTALKSDIAHRSDNEAERQAADDILGLMTPILKG
FT                   VLTDKGFDHTVVAQQLFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAI
FT                   NGGRAVMALFKEIGDFCEENRGDERLSAYTKALKKGLNDLQAATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVVLGYMWAKIAKTAHDKLAAGETAQADYLKNKLITANFFMERILPET
FT                   ALRKARIETGADTLMALDAAAF"
     atgcccattt acaaggctcc ggtcgacgac accctgttca tcctcaacga cgtgctcggc        60
     ctcgagcgct atcacaacct gccgggtttt gcggatgcga cgccggacat ggtggcggcg       120
     atcctcggcg aggccgccag acttgccgag gaagagctct ttccgatcaa tctttccggc       180
     gatcaggagg gctgcaagcg caacgacgat gggtcagtca ctacgccggc cggcttcaag       240
     caggccttcg atctctaccg cgagggcggc tggctgggcc tcgccgcgcc ggaggagttc       300
     gggggccagg gcctgcccta cacgcttcac accgccgtcg gcgaattcct gtccgccgcg       360
     aacatgtcgc tgatgatgta tccgggcctg acgcagggcg ccattgccgc catcctcgtg       420
     cacggctccg aggagcagaa gcgcgcctac ctgccgaaga tggtcgacgg cacctggacc       480
     ggcaccatga acctgacgga gccgcattgc ggcaccgatc tgggcctgct tcgcaccaag       540
     gccataccga acggcgacgg gtcctacagg atctccggcc agaagatctt catctccgcc       600
     ggcgagcacg acatggccga gaacatcatc catctggtgc ttgcccgtat cgagggcgcg       660
     ccggaaggcg tcaagggtat ctcgctcttc atcgtgccga agttcaagct gaacgacgac       720
     ggtgagcccg gcgcgcgcaa cggcgtttcc tgcggcgcga tcgaacacaa gatgggcatt       780
     cacggcaact ccacctgcgt gatgaactat gacgaggcga ccggctatct gatcggcgcg       840
     gagaacaagg gcctcaacgc catgttcgtg atgatgaacg aggcccgcct tgccgtcggc       900
     atgcagggac tggcgatcgc cgagatcgcc tatcagaatg ccgccaatta cgcccgcgaa       960
     cgcctccagg gccgctcgct ttccggcgtc aaggcgcccg agcagaaggc cgacccgatc      1020
     atcgtccatc cggacgtgcg ccgctcgctg atgacgatca aggccttcaa cgaggccggc      1080
     cgcgccttca ccctctggac ggcactgaag tccgatatcg cccaccgctc cgacaacgaa      1140
     gcggagcggc aggcggccga cgacattctc ggcctgatga cgccgatcct gaaaggcgtg      1200
     ctgaccgaca agggtttcga ccatacggtc gtggcgcaac agctgttcgg cggccacggc      1260
     tatatcgaag agcacggcat gagccagtat gtccgcgacg cccgcatcgc catgatctac      1320
     gagggcgcga acggtatcca ggcgctcgac ctcgtcggcc gcaagctcgc aatcaacggc      1380
     ggccgcgccg tcatggcgct gttcaaggaa atcggcgatt tctgcgagga gaaccgcggc      1440
     gacgaaaggc tctccgccta caccaaggcg ctgaagaagg gcctcaacga cctgcaggcg      1500
     gcaaccatgt ggttcatgca gaacgccatg gccaagcccg acaatgccgg cgccggctcg      1560
     accgactaca tgcatctctt cggcctcgtc gtcctcggct acatgtgggc gaagatcgcc      1620
     aagactgcgc atgataaact tgccgctggc gaaaccgcac aggcggacta cctgaagaac      1680
     aagctgatca ccgccaactt cttcatggag cgaatcctgc cggagacggc gctgcgcaag      1740
     gcgcgcatcg aaaccggcgc cgacacgctg atggcgctgg acgccgccgc gttctga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page