(data stored in ACNUC7421 zone)

EMBL: CP001389.PE166

CP001389.PE166       Location/Qualifiers
FT   CDS_pept        189749..193432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01700"
FT                   /product="hypothetical protein contains peptidoglycan
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23970"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR9"
FT                   /protein_id="ACP23970.1"
FT                   /translation="MNGSRSNPQRTGSPSYGDRPSLDALNRTIEGLEARIEGLMSSVGR
FT                   EQRQPDRRAAPANNAVSEILDRQRALSGARERLPLRERISARQSDRPVPAPARLAEEPR
FT                   YQPTPPVPTQPPRPSAATDIAEALVGLRQDLKRDISDGFAREMHALRSEIRGIKAEASE
FT                   DRGYAADIRADLQRLADNINQLGRQAPSAQADALRVEFDDLRAMIDGLAREDSMRRMES
FT                   RWSGVEDRLNAFDQNRDDELVALAYRLDEIKSQIGTLSQVSAVDMLEDKLVVVARAIET
FT                   LGRQMEPDDRRFASQFAELDQRLDEISRAVAVGRNAASLDSAFVNRLENRLGDLSHQID
FT                   NLARPVDAGLGARIEALSARVEDLAGDRAAARLEERLDQLSALLERSQRNVAPELADYL
FT                   ADISRRIEALDQGSVNDVLAERLDYLARRIDELDGHGESPAPDMRFDRLEDRLADIAQR
FT                   LEETQAAPFDDREALRNLEAQIGNLSALVSRSHQEPAGAAPIEFESRMTALEDYLATSD
FT                   EYIIEAARQAAEAVMEAYARNGMPQTASGTDMAAISALAEDLRALEDISRSSEERTART
FT                   FEALHDTLVHIAEKLERLEEREPGAGVRIASPNAPAMPKAVEPEFAGAFNEADLARQGS
FT                   LQRLGTAVDADVDVTVASPVAADLSPSGAASQVAVPAAKAGLLAGLTRRFSAKRNETAP
FT                   AQARQMVEPTPSIDPSEMLAPEDANQLLEPGSGVPDVKKILERVRAGQMARGGQSADGG
FT                   EKADFIAAARRAAQMAVEEADSLKSAKDHKGPSAAGGAFARHRRPILMAVGAVLLAIMS
FT                   YPLVSTMLKDRDAESVQPAAAIERKAEAEIAPKAVGEEAAKPLAAAVAAKPAGLPKAAA
FT                   PVEKTGTPPIATKAAATGGDKPAAAVPAVEAGQAPLLQPVAEPAKSGPVSTFQPTSPGA
FT                   PTVANFAPVKANEIVLPEGFGPPALLTAAKGGDPLAYYEIGTRFTEGRGVKEDLVEAGK
FT                   WYQRAADAGVVPAAYRLANLYEKGAGVARDAAKAKALYQKAAEAGNASASHNLAVMLAS
FT                   GRDGAPDLAAAAKWFEKAADLGVRDSQFNLAVLYARGNGVAQSLEDSYKWFAIAARDGD
FT                   KDAGEKRDEIAKALKPEELASAKAKAEAWKVQPVDAGANTVDVPDAWIGPSTKTASVDM
FT                   TKAVRNIQAILNNNGFDAGAPDGHMGKKTIAAIKAFQKSIGHEPTGEVTDELVKELLKR
FT                   NS"
     atgaacggat cgcgatccaa tcctcagcgc acaggcagcc catcctatgg cgacaggccg        60
     tcgcttgatg ccctgaaccg gacaatcgaa ggcctcgagg cgcgcatcga gggcctgatg       120
     agcagcgtcg gccgcgagca gcgccagccg gaccgccggg cagcgccggc gaacaacgcc       180
     gtttccgaaa tactcgaccg ccagcgcgcc ctgagcggcg cacgggagcg gctgccgttg       240
     cgcgagcgca tttcggcgcg tcaatccgat cgcccggttc ccgcgcccgc gcgccttgcg       300
     gaagagccgc ggtaccagcc aaccccgccg gtgccgaccc agccgccgcg cccgtccgcg       360
     gcaaccgata tcgccgaggc tctcgtcggc ttgagacagg atctgaagcg cgatatcagc       420
     gacggatttg cccgcgaaat gcatgccctt cgctcggaaa tccgtggcat caaggccgag       480
     gcttccgaag accgcggcta cgccgccgat atccgcgccg atttgcagcg gctcgccgac       540
     aacatcaatc aactcggccg tcaggcaccc tcggcgcagg ccgacgcgct tcgcgtcgaa       600
     ttcgacgacc tgcgggcaat gatcgacggc ctggcgcgcg aagacagcat gcgccgcatg       660
     gaaagccgct ggagcggcgt cgaggatcgg ctgaatgcct tcgaccagaa ccgtgatgac       720
     gagctcgtgg cgctcgccta ccgtcttgac gaaatcaagt cgcagatcgg cacgctgagc       780
     caggtctcgg cggtcgatat gctggaggac aagctcgtcg tcgtggcgcg ggcgatcgag       840
     acgctcgggc gccagatgga gccggacgac aggcgcttcg cctcgcagtt cgccgaactc       900
     gatcagcggc tcgacgaaat cagccgggcg gtcgccgtcg gccgcaatgc cgccagcctc       960
     gacagcgcct tcgtcaaccg gctggaaaac cgccttggcg atctctcgca ccagatcgac      1020
     aatcttgctc gcccggtgga cgctggcctt ggcgcacgga tcgaggcgct gtcggcgcgc      1080
     gtcgaagacc ttgccggcga cagggccgcg gcccggctcg aggaacggct cgatcagctt      1140
     tccgcgctgc tggagcgcag ccagcgcaat gtggcgccgg aactggcgga ctaccttgcc      1200
     gatatttcgc gcaggatcga ggcgctggac cagggcagcg tcaacgatgt cctggcggaa      1260
     cgattggatt acctcgcccg ccgaatcgac gaactggacg gccatggcga atcgccggcg      1320
     ccggacatgc gcttcgaccg gctcgaggac cggcttgccg atatcgcgca gcgcctggag      1380
     gaaacacaag ccgcgccgtt cgacgatcgc gaggcgctgc gcaatctcga agcgcagatc      1440
     ggcaatctct cggcgctggt gagccggtcg catcaggagc cggccggcgc cgcgccgatc      1500
     gagttcgaaa gccgcatgac ggcgctcgaa gactatctgg cgaccagcga cgaatacatc      1560
     atcgaagcgg cccggcaggc cgccgaagcg gtgatggagg cctatgcccg gaacggcatg      1620
     ccgcagaccg cctctggcac cgacatggcg gcgatctcgg cgctcgccga agatctccgg      1680
     gcgctcgagg atatcagccg ttcgagcgaa gagcgcacgg cgcgcacctt cgaggccctg      1740
     cacgacacgc tcgtccacat cgccgagaaa ctggaacggc tcgaagaacg agagccgggt      1800
     gccggcgtgc ggatcgcctc gcccaacgcg ccggcaatgc cgaaagcggt ggagcctgaa      1860
     tttgcaggtg ctttcaacga agccgatctt gcgcggcagg gaagccttca gcggcttgga      1920
     acggctgttg atgccgacgt tgacgtcacg gtcgcaagcc cggtcgccgc cgacctgtct      1980
     ccctccggcg ctgcttcgca ggtcgcggtc ccggcagcaa aagccggctt gctcgccggc      2040
     ctgaccaggc gtttctccgc caagcgcaac gagacggcgc ccgcgcaggc gcgccagatg      2100
     gtcgagccca ccccctcgat cgatccgtcc gaaatgctcg ccccggagga cgccaaccag      2160
     ttgctcgagc cgggctccgg cgtaccggac gtcaagaaga tcctcgagcg cgtgcgggcc      2220
     gggcaaatgg cccgcggcgg ccagtcggca gacggcggcg aaaaggcgga tttcatcgct      2280
     gcggcccgcc gtgctgcgca aatggccgtt gaggaagccg attcgctgaa gagcgccaag      2340
     gaccataagg gaccgtccgc cgcagggggt gccttcgccc gccatcgccg cccgatcctc      2400
     atggcggtcg gtgcggtgct gctggcgatc atgtcctatc cgctggtcag cacgatgctg      2460
     aaggacaggg acgcagagag cgtccagcct gccgcggcga tcgaacgcaa agctgaagcc      2520
     gaaattgcgc cgaaggccgt cggcgaggaa gcggccaagc cgcttgccgc tgcggtcgcg      2580
     gcaaagcccg ccgggctgcc gaaggctgcc gctccggtcg agaagaccgg cacgcccccc      2640
     attgcgacga aggcagccgc gacgggaggc gacaagcctg ccgcagccgt tccggccgtc      2700
     gaggctggcc aggcgcccct cttgcagccc gtggccgagc cggcaaagtc ggggccggtc      2760
     tcgacattcc agccgacgag cccaggcgca cccacggtcg cgaattttgc gccggtcaag      2820
     gcgaacgaaa tcgtcctgcc cgaaggcttt ggtccgccgg cgctgttgac tgccgcgaag      2880
     ggcggcgatc cgctcgccta ttacgagatc ggcacccgtt tcaccgaggg acgcggcgtc      2940
     aaggaagatc ttgtcgaagc tggcaaatgg tatcagcgcg ccgccgatgc cggcgtcgtt      3000
     ccggccgcct accgtctcgc caatctctac gagaaggggg cgggcgttgc gcgggatgcc      3060
     gccaaggcca aggccctcta ccagaaggcc gccgaggcgg gcaacgccag tgcgagccac      3120
     aatctcgcgg tgatgcttgc cagcggccgc gatggtgcgc cggatctcgc cgcagccgcg      3180
     aaatggttcg agaaggccgc cgatctcggc gtccgcgaca gccagttcaa tctcgccgtg      3240
     ctctatgccc ggggcaacgg cgtcgctcag agcctcgagg actcctacaa gtggttcgcg      3300
     atcgccgcgc gcgacggcga caaggacgcc ggcgaaaagc gcgacgagat cgccaaggcg      3360
     ctgaagcccg aggagctcgc gagcgccaag gcgaaggccg aggcctggaa agtccagccg      3420
     gtcgatgccg gcgcgaatac ggtggatgtt ccggacgcct ggatcggacc ctcgacgaag      3480
     acggcgtcgg tcgacatgac gaaggcggtg cgcaacatcc aggccattct caacaacaac      3540
     ggcttcgatg ccggcgcgcc cgacggccac atgggcaaga agacgatcgc cgcgattaag      3600
     gcgttccaga agtcgatcgg ccacgagccg accggtgaag tcaccgacga actggtgaag      3660
     gaacttttga agcgcaattc atga                                             3684
//

If you have problems or comments...

PBIL Back to PBIL home page