(data stored in ACNUC7421 zone)

EMBL: CP001389.PE167

CP001389.PE167       Location/Qualifiers
FT   CDS_pept        193822..194748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01710"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23971"
FT                   /db_xref="GOA:C3MFS0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS0"
FT                   /protein_id="ACP23971.1"
FT                   /translation="MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGTIDIKLGTVLLCGGLVGATLGVWLFSLL
FT                   RSIGQLDLVISLLYVVLLGSVGGLMLWESIGAMRKAARNQPTQLRRPGQHNWIHGLPLK
FT                   MRFKKSKIYLSVIPVATLGFSIGILTSIMGVGGGFIMVPAMIYLLRIPTSVVVGTSLFQ
FT                   IVFVSAYTVIVQASTNYTVDIVLAFVLMIAGVIGAQYGVRVGQRLRGEQLRALLALLVL
FT                   AVGIRLAIELIIPPKDIYSVVSAGFGF"
     gtgacggtct atctgcccat tgcagaattg tcggtgaaca tattcatcat tctcggcatg        60
     ggcgcggccg tcggttttct gtcgggcatg ttcggggtgg gcggcggctt cctgatcacg       120
     cctctcctga tcttctacaa cattccgccg gtggtggcgg tggcgaccgg ggcgaaccag       180
     gtggtcgcct catcgatctc cggagcgatc acccatttcc ggcgcggcac gatcgacatc       240
     aagctcggaa cggtgctgct ctgcggcggt ctcgtcggcg cgaccctggg tgtctggctg       300
     ttttcgctgc tgcgcagcat cggccagctc gatctcgtca tttcgctgct ctacgtcgtc       360
     ttgctcggct cggtcggcgg cttgatgctc tgggagagca tcggcgcgat gcgcaaggcg       420
     gccaggaacc agccgactca gttgcgccgg cccggccagc acaactggat ccacggcctg       480
     ccgctgaaga tgcgcttcaa gaagtcgaag atctatctga gcgtcatccc ggtcgccacg       540
     ctcggcttct caatcggcat cctcacgtcg atcatgggtg tcggcggcgg tttcatcatg       600
     gtgccggcga tgatctatct cctgcgcatc ccgaccagcg tcgtcgtcgg gacctcgctg       660
     ttccagatcg tcttcgtctc ggcctatact gtgatcgtcc aggcctcgac caattatacg       720
     gtcgacatcg tgctggcctt cgtcctgatg atcgccggcg tcatcggcgc gcaatacggc       780
     gtgcgggtcg gccagcggct gcgcggcgag cagttgcggg cccttctggc gctgctcgtg       840
     cttgcggtcg gcatccgcct ggcgatcgag ctcatcattc cgccgaagga catctattcg       900
     gtggtttccg cggggttcgg cttctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page