(data stored in ACNUC7421 zone)

EMBL: CP001389.PE169

CP001389.PE169       Location/Qualifiers
FT   CDS_pept        195720..195956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01730"
FT                   /product="putative transcriptional regulator protein, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23973"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS2"
FT                   /protein_id="ACP23973.1"
FT                   /translation="MKPIFVQLQCAPGRTYDVADEIYRKEIVSEMYSTSGDYDLLLKIY
FT                   VEEGQDIGKFINDNIASVPGISRSLTTLTFNAF"
     atgaaaccga ttttcgtgca attgcaatgc gctcccggcc ggacgtacga tgtcgccgac        60
     gagatctacc gcaaggaaat cgtctcggag atgtattcga cgagcggtga ctacgacctg       120
     ctcttgaaga tctatgtcga ggaaggccag gatatcggca agttcatcaa cgacaatatc       180
     gccagcgttc cgggcatttc ccgttcgctg acgacgctca ccttcaacgc cttttag          237
//

If you have problems or comments...

PBIL Back to PBIL home page