(data stored in ACNUC7421 zone)

EMBL: CP001389.PE170

CP001389.PE170       Location/Qualifiers
FT   CDS_pept        complement(195958..196689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01740"
FT                   /product="putative phosphoesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23974"
FT                   /db_xref="GOA:C3MFS3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS3"
FT                   /protein_id="ACP23974.1"
FT                   /translation="MTMHRLVHATSAIETSALFQARTTVNGVAAICDALGGLFLPDTRT
FT                   LVVSDLHLEKGSAFARRGMMLPPYDTLATLRILEAIVARYDPATVISLGDNFHDRRGSV
FT                   AMPDTFRQMITAMARGRDWIWINGNHDPDGASGLPGASMDELRHAGLVFRHEPSMADGL
FT                   GEIAGHMHPSATVRRRERSIRRACFATDGRRLLMPAFGVTTGGLDLRHRAMSGLFDRQQ
FT                   LVAHMLGRDRIYSVRFANLLG"
     gtgaccatgc accggctcgt tcatgcgaca tcggctatcg agacaagcgc cttgttccag        60
     gcgcgcacga cggtcaacgg cgtggccgcc atctgcgatg cgctcggcgg tctctttctg       120
     cccgacaccc ggacactggt ggtgtccgac ctccacctcg aaaagggctc ggccttcgcc       180
     cggcgcggca tgatgctgcc gccctatgac acgctggcga ccctgcgcat tctcgaggcg       240
     atcgtcgcgc ggtacgatcc cgcaacggtg atcagcctcg gcgacaattt ccatgaccgg       300
     cgcggctcgg tagcgatgcc ggatactttc cgccagatga ttaccgcgat ggcccgcggc       360
     cgcgactgga tctggatcaa cggcaatcac gacccggacg gcgcctccgg cctgcccggc       420
     gcctcgatgg acgagctgcg tcatgcgggg cttgtcttcc gccatgagcc ctccatggca       480
     gacggcctcg gcgaaatcgc cggtcacatg catccctcgg caacggtccg gcgccgggaa       540
     aggtccatcc ggcgcgcctg ctttgcgacg gacggcaggc gcctgctgat gccggccttc       600
     ggcgtcacca ccggcggact cgatctccgg caccgcgcca tgagcggcct cttcgacaga       660
     caacagctcg tcgcccacat gctcggccgc gaccggattt attcggtgcg ctttgccaac       720
     ctgttgggtt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page