(data stored in ACNUC7421 zone)

EMBL: CP001389.PE171

CP001389.PE171       Location/Qualifiers
FT   CDS_pept        complement(196951..199599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01750"
FT                   /product="predicted ATP-dependent RNA/DNA helicase protein,
FT                   DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23975"
FT                   /db_xref="GOA:C3MFS4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS4"
FT                   /protein_id="ACP23975.1"
FT                   /translation="MDGLRPSPRINPERGNCAHTASGFSFVSFDLPLFPVDRIDSPLPE
FT                   SDALTLPAPFLRWFAEKGWRPRAHQLELLSRAEAGQSTLLIAPTGAGKTLAGFLPSLVD
FT                   LVRRGRIPPGSAFIGIHTLYISPLKALAVDIERNLMKPVNEMGLPVRIENRTGDTPQAK
FT                   RQRQKLSPPDLLLTTPEQLALLIADGEAERFFKDLRYVVLDELHSLVTSKRGHLLALGL
FT                   ARLRRLAPGLQTIGLSATVAAPMELQRWLVGQTPDEESYAGLITVSGGAKPEISILRAE
FT                   SHVPWAGHSARYAIPDIYAAIKAHGTTLLFVNTRSQAEMLFRELWTINDDNLPIALHHG
FT                   SLDVAQRRKVEAAMAENRLRAVVATSTLDLGIDWGDVDLVVHVGAPKGASRLAQRIGRA
FT                   NHRMDEPSRAILVPANRFEVMECQAALDANYVGAQDTPPVGKGALDVLAQHVLGMACAK
FT                   PFDPLALYDEITSAAPYADLSWETFERVVDLVATGGYALRTYERYARVRKTKEGLWRVS
FT                   NPMVAQQYRLNVGTIVESPMLNVRMVKRNARGSLGRGGMSLGKVEEYFLEMLSPADTFL
FT                   FSGKVLRFEGIRENECLVSQAFSFDPKVPSYAGGKFPLSTYLAAQVRKMLADPARRATL
FT                   PDQVRDWLALQGDASMLPREDELLVETFPRGSRHYMVTYAFEGRLAHQTLGMLLTRRLD
FT                   RAGLKPLGFVATDYSLGIWALDDMGAAFRAGAPSLAQLFDEDMLGDDLEAWLNESFLLK
FT                   RTFRTCAVIAGLIDQRHPGKEKTGRQVTVSADLIYDVLRMHEPDHILLEATRNDAASGL
FT                   LDIGRLGTMLKRIKGHITHRRLDRISPLAVPVMLEIGRESVHGEAQDFLLTEAADELIN
FT                   EAMGIGQAAGE"
     ttggatggtc ttcgcccctc tcctcggatt aatcccgaga ggggcaattg cgcgcataca        60
     gcatcgggct tctcttttgt ctcgtttgat ctacctttgt tccccgtgga caggatcgat       120
     tccccattgc cggaaagcga cgccctgacg ttgccggcgc cctttctgcg gtggttcgcg       180
     gaaaagggct ggcgaccgcg cgcccaccag ctggaactgc tgtcacgggc cgaggcaggg       240
     caaagcacgt tgctgatcgc gccgacgggt gcggggaaga cgcttgccgg cttcctgccg       300
     tcgctggtcg atctcgtgcg gcgcggccga attccgccgg gctccgcctt catcggtatt       360
     cacacgctct atatttcgcc gctcaaggcg ctcgccgtcg atatcgagcg caacctgatg       420
     aagccggtca atgaaatggg cctgccggtc cggatcgaga accgcaccgg agacacgccg       480
     caggccaaga ggcagcgcca gaagctcagc ccgcccgacc tgttgctgac cacgccggag       540
     cagcttgcgc tgctcatcgc cgatggcgag gcggagcgct tcttcaagga cctgcgctat       600
     gtcgtgctcg acgagctgca ttcgctcgtc acctcgaagc ggggccatct gctcgccctc       660
     ggcctcgccc gtctgcgccg cctggcgccg ggcctgcaga cgatcggcct ttcggcgacg       720
     gtggccgcac cgatggaact gcagcgctgg ctggtcggcc agacaccgga cgaggagagc       780
     tacgccggac tgatcaccgt atcgggcggg gcaaagcccg agatctccat tctgcgcgcc       840
     gagagccacg tgccctgggc ggggcattca gcccgttatg cgatcccgga catctatgcg       900
     gcgatcaagg cccacggcac gacgttgctc ttcgtcaata cgcgcagcca ggcggaaatg       960
     ctcttccggg agctctggac gatcaacgac gacaatttgc cgatcgccct ccaccacggc      1020
     tcgctcgacg tcgcccagcg ccgcaaggtg gaggcggcga tggcagagaa caggctgcgc      1080
     gccgtcgtcg ccacctcgac actcgatctc ggcatcgact ggggcgacgt cgacctggtt      1140
     gtccatgtcg gcgccccgaa gggagcgagc cgactcgccc agcgcatcgg ccgcgccaat      1200
     caccgcatgg acgagcctag ccgggcgatc ctcgtccccg ccaaccgctt cgaggtgatg      1260
     gagtgccagg cggcgctcga cgccaactat gtcggcgcgc aggatacgcc gcccgtcggc      1320
     aagggcgcgc tcgacgtgct ggcacagcac gtcctcggca tggcctgcgc caagcccttc      1380
     gacccgctgg cgctttatga cgagatcacc agcgcggctc cttatgccga tctttcctgg      1440
     gagaccttcg aacgggtcgt cgacctcgtc gccacaggcg gctacgcgct gcgcacctat      1500
     gagcgctacg cccgcgtccg caagacgaag gaagggttgt ggcgggtttc caatccgatg      1560
     gtcgcacagc aataccgcct caatgtcggg acgatcgtcg aatcgccgat gctgaacgtg      1620
     cgaatggtca agcgcaacgc acgcggctcg ctcggccgcg gcggtatgtc gctcggcaag      1680
     gtggaggagt atttcctcga aatgctgtcg ccggccgaca cgtttctctt ctccggcaag      1740
     gtgctgcgct ttgaaggcat ccgcgagaac gagtgtctcg tttcgcaggc cttttccttc      1800
     gaccccaagg tgccgagcta tgccggcggc aagtttccgc tctccaccta tctcgccgcg      1860
     caggtcagga agatgcttgc cgacccggcg cggcgcgcca ccctgccgga ccaggtgcgc      1920
     gactggctgg cgctgcaggg cgacgcctcg atgctgccgc gcgaggacga actgctggtc      1980
     gagaccttcc cgcgcggcag ccgccactac atggtcactt acgccttcga gggacggctt      2040
     gcccaccaga cgctcggcat gctgttgacc cgccggctcg accgggctgg cctgaagccg      2100
     ctcggcttcg tcgccaccga ctattcgctc ggcatctggg cgctcgacga catgggcgcg      2160
     gcatttcgcg ccggcgcgcc atcgctcgca cagctcttcg acgaggacat gctcggcgac      2220
     gacctggagg cctggctgaa cgaatccttc ctgctgaaac gcacctttcg gacctgcgca      2280
     gtgatcgccg gattgatcga ccagcgccac ccgggcaagg aaaagaccgg ccgccaggtc      2340
     acggtttccg ccgacctcat ttacgacgta ttgcggatgc acgagcccga ccacatcctg      2400
     ttggaagcaa cgcgcaacga cgcggcgtcg ggccttttgg acattggccg gctcggcact      2460
     atgctcaagc gaatcaaagg gcacatcacc catcgccggc tcgatcgtat ctcgccgctc      2520
     gccgttccgg tcatgctgga aatcggccgg gaatcggttc acggagaggc ccaggacttc      2580
     ctgctgacag aagccgccga cgagctgatc aacgaggcga tggggatcgg ccaggctgcg      2640
     ggggaatag                                                              2649
//

If you have problems or comments...

PBIL Back to PBIL home page