(data stored in ACNUC7421 zone)

EMBL: CP001389.PE172

CP001389.PE172       Location/Qualifiers
FT   CDS_pept        complement(199603..200238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01760"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23976"
FT                   /db_xref="GOA:C3MFS5"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS5"
FT                   /protein_id="ACP23976.1"
FT                   /translation="MAQTSSVFGLWNTSPTRHTPIEDVQGVFSGSLVAALGLYFLASAG
FT                   LLTGSTAGVAFLLHYATGVNFSLAFFLLNLPFFYLSLKQLGAAFTIKTFIAIGVTSLLT
FT                   DAQSRLFEIEQIHPGWAALLGGLLLGYGVLALYRHRASLGGVGILGVYLQERFGIRAGL
FT                   VQLAIDMVVLGVAFAVTTPWVVLWSVLGAVVLNLFVAINHRADRYIAL"
     atggcacaga cgagcagcgt tttcggtctc tggaacacca gccccactcg gcatacgccg        60
     atcgaggatg tgcagggcgt cttttccggc agcctcgtcg cagccctcgg gctctacttc       120
     ctcgcaagcg ccgggctgct gaccggaagc accgccggtg tcgccttcct gctgcactat       180
     gcgaccggcg tgaatttcag cctcgccttc ttcctgctca acctgccgtt cttctacctg       240
     tcgctgaagc aactcggggc ggcttttacc ataaaaacct tcatcgccat cggggtgacc       300
     tctttgctga cggacgcgca atcgcggctt ttcgagatcg aacagatcca tcccggctgg       360
     gcggcccttc tcggcgggtt gttgctgggc tatggcgttc tggcgctcta ccgccaccgc       420
     gccagcctgg gtggcgtcgg catcctcggc gtctatctgc aggagcgctt cggcatccgt       480
     gccggcctcg tgcaactcgc gatcgacatg gtggtccttg gcgttgcctt tgcagtgacg       540
     acgccgtggg tcgttctctg gtcggtgctc ggcgcggtcg tcctcaacct cttcgtggca       600
     attaaccacc gcgccgatcg ttacattgcg ctctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page