(data stored in ACNUC7421 zone)

EMBL: CP001389.PE175

CP001389.PE175       Location/Qualifiers
FT   CDS_pept        201695..202198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01790"
FT                   /product="conserved hypothetical protein contains SCP-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23979"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS8"
FT                   /protein_id="ACP23979.1"
FT                   /translation="MQDQFFLPRRRLVLSAGAALSLGLVAGCSTTGLLTPDDGTGSDQT
FT                   DATLGYVNTLRKGKGLATLERDPAASVAAMHQAARMARAGKMKHNIGWRDDFADRMKGD
FT                   GVTLPAAENIAMGQDNAERAYEAWFNSPKHLENMLGRYRGLGVAVAQNTASGNRPFWAM
FT                   VLSG"
     atgcaggacc aattctttct tccccgcaga cggcttgttc tgtccgccgg tgccgccctc        60
     tcgctcgggc ttgtcgccgg ctgctcgacc accggtctcc ttacgcccga cgacggcacg       120
     gggagcgacc agaccgacgc gacgcttggc tacgtcaaca cgctgcgcaa gggcaagggg       180
     cttgcgaccc tcgagcgcga ccccgccgcg tccgtcgccg cgatgcatca ggccgcccgc       240
     atggcacgcg ccggcaagat gaagcacaat atcggctggc gcgacgattt tgccgatcgg       300
     atgaagggcg acggcgtcac gcttccggcc gccgagaaca tcgccatggg ccaggacaac       360
     gccgagcggg cctatgaagc ctggttcaac tcgccgaagc acttggaaaa catgctcggc       420
     cgctatcgcg gcctgggcgt ggcggtggcg caaaataccg cttccggaaa tcggccgttt       480
     tgggcgatgg tgctctccgg ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page