(data stored in ACNUC7421 zone)

EMBL: CP001389.PE178

CP001389.PE178       Location/Qualifiers
FT   CDS_pept        complement(204675..205043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23982"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT1"
FT                   /protein_id="ACP23982.1"
FT                   /translation="MTDERTKMNATIYKIVPALLWQEARRAGQFAGAPIDLADGFIHFS
FT                   THDQVAETAARHFEGQTDLLLVAVDADALGDKLVYEPSRGGALFPHLYAPLTLDAVRWE
FT                   KPLPLGADGKHIFPELAP"
     atgacggacg agcggacgaa gatgaatgct accatataca agatcgttcc ggcgcttcta        60
     tggcaggaag cccggcgcgc cgggcaattc gccggcgcgc ccatcgatct cgccgacggc       120
     ttcattcact tctccacgca cgaccaggtc gctgagacgg cggcgcggca tttcgagggc       180
     cagacggatc tgctgctcgt cgccgtcgac gccgacgcgc tcggcgacaa gctcgtctac       240
     gagccctcgc gcggcggtgc gctgtttccg catctctatg cgccgctgac gctcgacgcg       300
     gtgcggtggg aaaagcccct gccgctcggt gccgacggca agcatatctt ccccgagctt       360
     gcaccatga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page