(data stored in ACNUC7421 zone)

EMBL: CP001389.PE179

CP001389.PE179       Location/Qualifiers
FT   CDS_pept        205141..205572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23983"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT2"
FT                   /protein_id="ACP23983.1"
FT                   /translation="MKKVVAALAFGLALGGSHSAWAQEAAPGRFSMQKAETGFARLDTE
FT                   TGEVTLCQEKNGELVCRMAADERAAFERELDLLTKRVEALEKAVQGGATAVKPDLPTDE
FT                   EIDRTMSIMERMMRKFMDIVKELEGRDTTEEGGPVPDKT"
     atgaagaagg tagttgcagc gctcgcgttc ggcttggccc tcggcgggag ccattcggcc        60
     tgggcgcagg aagcggcgcc ggggcgcttc agcatgcaga aagcggagac gggatttgcc       120
     cggctcgaca cagagaccgg cgaagtcacc ctctgccagg aaaagaacgg cgaactcgtc       180
     tgccggatgg cagccgacga gcgcgctgcc ttcgagcggg aactcgacct gctcaccaaa       240
     cgggtcgaag cactggaaaa ggccgtgcag ggcggcgcga ctgccgttaa acccgatctc       300
     ccgaccgacg aagagattga ccggaccatg agcatcatgg aaagaatgat gcgcaagttc       360
     atggatatcg tgaaggagct cgaaggccgc gataccaccg aagaaggtgg accggtgccc       420
     gacaagacct ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page