(data stored in ACNUC7421 zone)

EMBL: CP001389.PE18

CP001389.PE18        Location/Qualifiers
FT   CDS_pept        complement(16666..17493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00180"
FT                   /product="predicted ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23822"
FT                   /db_xref="GOA:C3MEJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ9"
FT                   /protein_id="ACP23822.1"
FT                   /translation="MQDSDVQIPFLPKRKRVKKPSAAAVAARTVDKARYDGTLIARGLT
FT                   KSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGSIEINGNDVTT
FT                   MPMYRRARLGVGYLPQEASILRGLTVEENIRAVLEIHDKNVDRRESKLNDLLGEFSITH
FT                   LRKSPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQALVRHLTSRGI
FT                   GVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLGDNFSL"
     atgcaagatt cggacgtgca gattcccttt cttcccaaac gcaaacgggt caagaagccg        60
     tcggcggcag ccgttgctgc gcggacggtc gacaaggcgc gctatgacgg cacgctgatc       120
     gcccggggcc tgacgaaatc ctaccgctcg cggcgcgtcg tcaacggcgt ctcactcgtc       180
     gtgcggcgtg gcgaggcggt cggcctgctc ggcccgaacg gcgccggcaa aacgacctgc       240
     ttctacatga tcaccggact ggtcccggtc gacgagggat cgatcgagat caacggcaac       300
     gacgtcacca cgatgccgat gtaccgccgg gcccgcctcg gcgtcggcta cctgccgcag       360
     gaagcctcga tcctccgtgg gctgacggtc gaggaaaaca tccgcgccgt gctcgagatc       420
     cacgacaaga acgtcgatag gcgcgagagc aagctgaacg acctgctggg cgaattctcg       480
     atcacgcatc tgcgcaaatc gccggccatc gcgctctcgg gcggcgagcg gcggcgcctc       540
     gagatcgcgc gggcgctcgc gaccgacccg accttcatgc tgctcgacga acccttcgcg       600
     ggcgtcgatc cgatctcggt ggccgacatc caggcgctgg tgcggcatct gacctcgcgc       660
     ggcatcggcg tcctgattac cgatcacaac gtgcgcgaaa cgctgggact gatcgaccgc       720
     gcctacatca tccatgccgg cgaagtgctg acccatggcc gtgccaacga catcgtcacc       780
     aatccggatg tgcgccggct ctatctcggc gataatttca gcctttaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page