(data stored in ACNUC7421 zone)

EMBL: CP001389.PE181

CP001389.PE181       Location/Qualifiers
FT   CDS_pept        complement(206552..210058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01850"
FT                   /product="predicted two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23985"
FT                   /db_xref="GOA:C3MFT4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT4"
FT                   /protein_id="ACP23985.1"
FT                   /translation="MLSGSVILASAFAYLLLLFAVASYGDRRASRSKIASKGRPLVYAL
FT                   SLAIYCTSWTYFGGVGLAAEHGLEFTGIYIGPILMFTLGMPLIRRIVRLAKTEKLTSVA
FT                   DFVAARYGKNPAVAAIVALISLVGAIPYIALQLKAVSSSVAAMIDTSDYGIGAGENFID
FT                   LPLLVTLFLACFAIVFGTRHTDATEHQDGLILAIAMESVVKLVAMLTAGIYIVFVLFDG
FT                   PANLLAAAQQSPAVLSALEYQTPVARWILLIVLSSFGIIMLPRQFHVTVVENRTENELR
FT                   TAGILFPLYLIAINLFVLPIAIAGILTFSGSGDADLYLLALPLAGDVPFITLLTFIGGF
FT                   SAATAMVIVASVALSIMISNDIVMPVFLRQRLGTRGTLQESMAGTLLNIRRTAIFAVLL
FT                   LGYSYYRSADMSAGLASLGLLSFVAISQMAPALLGGLVWRQANARGAIAGMVSGFLVWA
FT                   YALFLPSLGGPDNSHVASTILSFLLPFTDLFSGPQSDPLVNASALSLLVNVFAYVLGSL
FT                   TRTPKPLERFQAGVFITRRSRTERAFRGRKTKVTVRDLKTTIARYMGDERMQRSFHTYE
FT                   QQSGRWLDENASADMALVHFSEQLLGSAIGSSSARLVFSLVLQRMDDPSSDTAWLLDQA
FT                   SEALQHNQDMLQTALSQMDQGIAVFDNASNLIIWNRRFRELLDLPEAAGQVGFPLADIV
FT                   AILARRGDIRKDEEKTLVANFLALDKPFLLELGNGTRIVEVRTNAMPDKGIVTTYTDIT
FT                   PRVAADMALKQANETLELRVAERTSELTRVNRELGEARAVAEDANIGKTRFFAAAGHDI
FT                   LQPLNAARLYSSSLVERLGDSDNKALVQNIDSSLESVEAILGAVLDISRLDTGAMKPRL
FT                   QAVPLNDLLRRIETDFAPMARAKDIAFTVMPTSLVVRSDPNLLRRVVQNLVSNAIKYTL
FT                   EGKVLVGVRQHGQTATIEVLDSGIGIPASKFRTVFKEFARLDEGARTASGLGLGLSIVD
FT                   RISRVLNHPVGLQSKPGKGTGFKVSVPLDTSATEPARPQPVAATKTSEALTGLAVVCID
FT                   NEPKILEGMALLLGGWGCAVTTVESVAACARMGPGNLPARPDAIVADYHLDDGTGIEAI
FT                   AAIRALWQESIPALMVTADRTPEVRGAAERDGVSLQHKPVRPAALRAWLTQLAAAGRTA
FT                   AE"
     atgctttcgg gttcggtcat tcttgcctcg gccttcgcct atctgctgct gctcttcgca        60
     gtcgcaagct acggcgaccg ccgggccagc agaagcaaga ttgccagcaa gggcaggccg       120
     ctggtctatg cgctgagcct ggcgatctac tgcacatcct ggacctattt cggcggcgtc       180
     gggctcgccg ccgagcacgg gctcgaattt accggcattt atatcggccc gatcctgatg       240
     ttcacgctcg gcatgccgct gatccgcagg atcgtgcggc ttgccaagac cgagaagctg       300
     acctcggtcg ccgatttcgt ggcggcgcgc tacggcaaga acccggcggt ggcagcgatc       360
     gtcgcgctga tctcgctggt cggggccatt ccctatatcg ccctccaact caaggcggtt       420
     tcgagctccg tcgctgcgat gatcgacacc agcgattacg gcatcggcgc gggggaaaac       480
     ttcatcgacc tgccgctgct cgtcaccctc tttctcgcct gcttcgcgat cgtcttcggc       540
     acccgccaca cggatgcgac cgaacatcag gacggcctga tcctggcgat cgcgatggaa       600
     tcggtcgtca agctcgtcgc catgctgacg gcgggcatct acatcgtgtt cgtgctgttc       660
     gacgggccgg cgaatctgct ggccgcggcc cagcaaagcc ccgcggtgct ttccgctctc       720
     gagtaccaga cgccggtggc gcgctggatc ctgctgatcg ttctctcgtc cttcggcatc       780
     atcatgctgc cgcggcagtt ccacgtcacc gtcgtcgaaa accgcaccga gaacgagctg       840
     cgcaccgccg gaatattgtt tccgctctac ctgatcgcca tcaacctctt cgtcctgccg       900
     attgccattg cgggaatcct gaccttctcc ggctccggcg acgccgacct ctatctcctc       960
     gccctgccgc tcgccggcga cgtgcccttc atcacgctgc tcaccttcat cggcggcttc      1020
     tccgccgcca cggccatggt catcgtcgcc tcggtggcgc tgtcgatcat gatctccaat      1080
     gatatcgtca tgccggtttt cctgcgccag cggctcggca cgcgcggcac actccaggag      1140
     agcatggccg gcacgctgct caatatccgc cgcacggcga tcttcgccgt cctgctgctt      1200
     ggctacagct attatcgctc ggccgacatg agcgccggcc tcgcctcgct gggactgctc      1260
     tccttcgtcg ccatttcgca gatggccccg gcgctgctcg gcggtctcgt ctggaggcag      1320
     gcgaacgccc gcggcgcgat tgccggaatg gtcagcggct tcctggtctg ggcctatgcc      1380
     ctgttcctgc cgagcctcgg cgggcccgac aattcgcacg tcgcctcgac cattttgagc      1440
     ttcctcctac cgtttacgga tctcttttcg gggccgcagt ccgacccgct cgtcaacgca      1500
     tcggccctca gcttgcttgt caatgtattc gcctatgtgc tcggctcgct gacccggacc      1560
     ccgaagccgc tcgagcgctt ccaggccggc gtgttcatca cccgccgctc gcgcacggag      1620
     cgggccttcc gcggccgcaa gacgaaggtg acggtgcgcg acctcaagac aacgatcgcc      1680
     cgctatatgg gtgacgagcg catgcagcgg tcattccaca cctatgagca gcagtccggg      1740
     cgctggctcg atgaaaacgc ctccgccgac atggcccttg tccatttttc cgaacaattg      1800
     ctcggcagcg ccatcggctc ctcttcggcc cggctggtgt tttcgctggt gctgcagcgc      1860
     atggacgatc cctcctcgga taccgcctgg ctgctcgatc aggcaagcga ggccttgcaa      1920
     cataaccagg acatgctgca gacggcgctc tcgcagatgg accagggcat tgcggtcttc      1980
     gacaatgcca gcaatctgat catctggaac cgccgtttcc gggaattgct cgatctgcct      2040
     gaggccgccg gccaggtcgg cttcccgctt gccgatatcg tggcgatcct ggcgcgccgc      2100
     ggcgacattc gcaaggacga ggaaaagacg ctggtcgcca acttcctggc gctcgacaag      2160
     ccgtttctgc tggagctcgg caatggcacc cggatcgtcg aggtccggac caacgccatg      2220
     cccgacaagg gcatcgtcac cacctacacc gacatcaccc cacgcgtcgc ggccgacatg      2280
     gcactcaagc aggcgaacga gacgctggag ctgcgcgtcg ccgagcggac aagcgaattg      2340
     acgcgggtca accgcgaact cggcgaggcg cgcgccgtcg ccgaggatgc caatatcggc      2400
     aagacccgct tcttcgccgc cgccggacac gatatcctgc agccgttgaa tgcggcgcgg      2460
     ctctattcct cgtcgctcgt cgagcggctc ggtgattccg ataacaaggc gctggtccag      2520
     aacatcgact cctcgctcga atcggtggag gccattctcg gggcagtgct ggacatctcg      2580
     cggctcgaca ccggcgcgat gaagccgcga ctgcaggccg tgccgctcaa tgatctgttg      2640
     cggcgcatcg agacggactt cgccccgatg gcgcgggcga aggacatcgc gttcactgtc      2700
     atgccgacct cgctcgtcgt gcgcagcgac cccaaccttt tgcggcgcgt cgtccagaat      2760
     ctcgtctcga acgcgatcaa gtacacgctt gagggcaagg tgctggtcgg cgtgcggcag      2820
     cacgggcaga cagcgacgat cgaagtgctc gactccggta tcggcattcc ggcatcgaaa      2880
     ttccgcaccg tgttcaagga attcgcacgc ctcgacgaag gggcgcgtac ggcctccggg      2940
     ctcggcctcg gcctttcgat cgtcgaccgc atctcacgtg tgctcaacca tccggtcggc      3000
     ctgcagtcta agcctggaaa gggcaccggt ttcaaggtta gcgtaccgct cgatacaagc      3060
     gccaccgagc cggctaggcc gcagccggtc gccgcgacga agacgagcga ggcactgacc      3120
     ggccttgctg tcgtctgcat cgacaacgag ccgaagatcc tcgagggcat ggcgctgctc      3180
     ctgggcggtt ggggctgcgc cgtcacaacg gtggaatcgg tggccgcctg cgctcggatg      3240
     ggcccgggaa acctgccggc acggcccgac gcgatcgtcg ccgactatca cctcgacgac      3300
     ggcaccggca tcgaggcgat cgccgcaatc cgcgcgcttt ggcaggagag cattccggcg      3360
     ctgatggtga ccgccgaccg cacgccggag gtccgcggcg ccgccgagcg tgatggggtc      3420
     tcattgcagc acaagccggt gcggcccgcc gccctccgtg cctggctgac ccagctcgcc      3480
     gcagcgggac ggacggcggc ggagtag                                          3507
//

If you have problems or comments...

PBIL Back to PBIL home page