(data stored in ACNUC7421 zone)

EMBL: CP001389.PE185

CP001389.PE185       Location/Qualifiers
FT   CDS_pept        complement(213427..213732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23989"
FT                   /db_xref="GOA:C3MFT8"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008241"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT8"
FT                   /protein_id="ACP23989.1"
FT                   /translation="MPKTPAECTTMADVRAEIDRLDRALMALFAERWGYIDRAAEIKRP
FT                   LNLKADIPARVAEVRENARRHAVAFGLEPDFYEELWAQLIDHAIAHERTLLGEDQE"
     atgccgaaga cccccgcaga atgcacgacg atggcagatg tgcgcgccga gatcgatcgg        60
     ctcgaccgcg ccctgatggc gctctttgcc gagcgctggg gctatatcga ccgcgccgcc       120
     gagatcaagc gcccgctgaa cctgaaggcc gacattccgg cgcgcgtcgc cgaggtccgc       180
     gagaatgccc gcaggcatgc ggtcgcgttc ggcctcgagc cggactttta tgaagagctg       240
     tgggcgcagc tgatcgacca cgcaatcgcc catgagcgca cgctcctcgg cgaagaccag       300
     gaataa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page