(data stored in ACNUC7421 zone)

EMBL: CP001389.PE186

CP001389.PE186       Location/Qualifiers
FT   CDS_pept        complement(214304..215308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01900"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23990"
FT                   /db_xref="GOA:C3MFT9"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT9"
FT                   /protein_id="ACP23990.1"
FT                   /translation="MALDLPFIWAALIAFAVLAYVVLDGFDLGVGILFPLFPEKHDRDV
FT                   MMNSVAPVWDGNETWLVLGGGGLMAVFPLAYATIMPALYAPIIAMLIGLIFRGVAFEYR
FT                   WRTKRAEYLWNWAFAGGSTLAAFAQGLALGALVQGIPIEDRAYAGGWWDWLTPFSIVTG
FT                   VAIVVGYALLGATWLIMKTRGDLAERARSIALKCAFGTIAAMGIVSLWTPFLERVYLQR
FT                   WFGWPTAIFSVIVPLLVLGCLYLLLKGIQERRDAQPFLAALGLFVLGYIGIGISFYPYM
FT                   VPPSLTIWDAAAPNESLAFLLVGALVLVPIILAYTAYAYWVFRGKVDPEEGYH"
     atggctcttg acctgccgtt catctgggcc gcccttatcg ccttcgcggt gctcgcctat        60
     gtcgtgctcg acggcttcga tctcggcgtc ggcatcctct ttccgctttt ccccgagaag       120
     cacgatcgcg acgtgatgat gaattccgtg gcgccggtct gggacggcaa cgagacctgg       180
     ctggtgctcg gcggcggcgg tctgatggcc gtcttcccgc tcgcctatgc gacaatcatg       240
     ccggcgcttt acgcgccgat catcgccatg ctgatcggcc tgatcttccg gggtgtcgcg       300
     ttcgaatatc gctggcggac gaagcgcgcc gaatatctgt ggaactgggc ctttgccggc       360
     ggatcgacgc tcgcagcctt cgctcagggg ctggcgctcg gcgccctcgt ccagggaatc       420
     ccgattgaag accgggccta tgccggcggc tggtgggact ggctgacgcc cttctccatc       480
     gttaccggcg tggcgatcgt cgtcggctac gccctgctcg gcgcgacctg gctgatcatg       540
     aagacgcgtg gcgatctcgc cgagcgtgcc cgctcgatcg ccctcaaatg cgctttcggg       600
     accatcgcgg cgatgggcat cgtcagtctc tggacgccgt ttctcgagcg ggtctacctc       660
     cagcgctggt tcggctggcc gacggcgatc ttcagcgtca tcgtgccgct gctcgttctc       720
     ggctgcctgt acctgctgct caagggcatc caggagcgcc gcgatgcgca gcccttcctc       780
     gccgccctcg gtctcttcgt gctcggttac atcggtatcg gcatcagttt ctacccctat       840
     atggtgccgc cgtcgctcac catctgggac gccgcagcgc cgaacgagag cctcgctttc       900
     ctgctcgtcg gcgcactcgt gctggtgccg atcatcctcg cctataccgc ctatgcctac       960
     tgggtcttcc gcggcaaggt cgatccggaa gagggctatc attga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page