(data stored in ACNUC7421 zone)

EMBL: CP001389.PE187

CP001389.PE187       Location/Qualifiers
FT   CDS_pept        complement(215298..216713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01910"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23991"
FT                   /db_xref="GOA:C3MFU0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU0"
FT                   /protein_id="ACP23991.1"
FT                   /translation="MFEAFDATLLARIQFAFTVSFHIIFPAFSIGLASYLAVLEALWLW
FT                   KKDAVYLELFNFWKTIFAVAFGMGVVSGIVMSYQFGTNWSVFSDKAGPIIGPLMGYEVL
FT                   TAFFLEAGFLGIMLFGLNRVGPRLHFLATVMVAIGTLISATWILSANSWMQTPAGFATN
FT                   EAGQFIPVDWWAIIFNPSFPYRLVHMVLAAYLTTALVVGACGAWHLLHNTAPRRARTMF
FT                   SMAMWMAAIVAPIQIFAGDQHGLNTLEHQPAKVMAMEGHYHSHPDGAPLVLFGIPNSAE
FT                   KRIDYAIEVPKLGSLILKHDLDAPLAGLDTIPDELHPPVAVVFWSFRVMVGMGLAMLGI
FT                   GLWSLWCRYRGTLDGDIWLHRAAVLMGPAGFVAVLAGWITTEVGRQPYTVYGHLLTANS
FT                   IAPIEAPAIGASLVAFIVVYFLVFGAGTFYILRLMARLPRDTMPELDEGPLRTAGVTPG
FT                   PATAKPHGGHHGS"
     gtgtttgaag cctttgacgc gacactgctt gcgcgcatcc agttcgcctt cacggtgtcg        60
     tttcacatca tctttccggc cttttccatc gggctcgcca gctacctcgc cgtcctcgaa       120
     gccctgtggc tgtggaagaa ggacgcggtc tatctggaac ttttcaactt ctggaagacg       180
     attttcgcgg tggccttcgg catgggcgtc gtttccggca tcgtcatgtc ctatcagttc       240
     ggcaccaatt ggagcgtgtt ttccgacaag gccggcccga tcatcgggcc gctgatgggc       300
     tatgaggtgc tgaccgcttt cttcctcgag gcgggcttcc tcggcatcat gctcttcggc       360
     ctgaaccgtg tcggtccgag actgcatttt ctggcaaccg tcatggtcgc catcggcacg       420
     ctgatctcgg ccacctggat cttgtccgcg aactcctgga tgcagacccc ggcgggtttt       480
     gcgacgaacg aagccggcca attcattccg gtcgactggt gggcgatcat cttcaatccc       540
     tcgttcccgt accgcctggt gcatatggtg cttgccgcct atctgacgac ggcgttggtg       600
     gtcggcgcct gcggcgcctg gcatctcctg cacaacacgg cgccgcggcg tgcccgcacg       660
     atgttctcga tggcgatgtg gatggcggcg atcgtcgcgc cgatccagat cttcgccggc       720
     gaccagcacg ggctcaacac gctcgagcac cagcccgcca aggtgatggc gatggagggt       780
     cactatcaca gccatcccga cggagccccg ctggtgctct tcggcattcc gaattccgcc       840
     gaaaagcgca tcgactacgc gatcgaggtg ccaaagctcg ggagcctcat cctgaaacac       900
     gatctcgatg cgccgctcgc cggactggac acgattcccg acgaattgca tccgccggtc       960
     gccgtggtct tctggtcgtt ccgcgtgatg gtcggcatgg gcttggccat gctcggcatc      1020
     gggctgtggt cgctctggtg tcggtaccgc ggcacgctcg acggcgacat ctggctccac      1080
     cgcgccgccg tgctgatggg gcctgccggc ttcgtcgcgg ttctcgcggg atggataacc      1140
     acggaagtcg gccgccagcc ttacactgtc tacggtcatc tgttgacggc caactcgatc      1200
     gcgccgatcg aggctccggc catcggcgca tcgcttgtcg ctttcatcgt cgtctacttc      1260
     ctcgtctttg gcgccggcac cttctacatc ctgcggctga tggctcgcct accgcgcgat      1320
     accatgccgg aactcgacga ggggcctttg cgcaccgccg gcgttacccc tggcccggcg      1380
     acggcgaaac cgcatggagg ccatcatggc tcttga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page