(data stored in ACNUC7421 zone)

EMBL: CP001389.PE189

CP001389.PE189       Location/Qualifiers
FT   CDS_pept        complement(218077..218901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01930"
FT                   /product="putative amino acid ABC transporter, inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23993"
FT                   /db_xref="GOA:C3MFU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU2"
FT                   /protein_id="ACP23993.1"
FT                   /translation="MTDETTHALALVPEDLPKAEAFLKPHRIVLMLVFAGLIVAIAVFM
FT                   RWDWLPRYLPRLGSGILVSLAMLFSTAILGFLLAVPLGLVQVTGPWFLKAPARLFCTVI
FT                   RGTPLLLQLWLLYYGLGSLFPQFPAIRHSLLWPYLREAWPYGVAALTLSFAAYEGEVMR
FT                   GAFAGVPQGELEAARAYGMGRWTTFRRIWLPRAVHRALPTLNGETVLQLKSTPLVATIT
FT                   VVDVYAVISKVRQETFLTYEPLLLLALIYLCLTGILVVAFRYFENRIPTRGA"
     atgaccgacg aaacgaccca cgcgctcgcg ctcgtccccg aggaccttcc caaggcggag        60
     gccttcctca aaccgcatcg catcgtcctg atgctggtct tcgcgggcct catcgtcgcc       120
     atcgccgtct tcatgcgctg ggattggctg ccgcgctacc tgccgaggct cggctccggg       180
     atcctcgtca gcctggcgat gctgttcagc acggcgatcc tcggcttcct gcttgccgtt       240
     ccgctcgggc tcgtccaggt caccggcccc tggttcctca aggccccggc ccgactgttc       300
     tgcaccgtca tccgcggcac gccgctgctc ttgcagctct ggctgctcta ttacgggctc       360
     ggctcgctct ttccgcaatt ccctgcgatc cgccattccc tcctctggcc ttacctgcgc       420
     gaagcatggc cctatggagt ggcggcgctg acgctctcct tcgcggctta cgagggggaa       480
     gtgatgcgcg gcgcctttgc cggcgtgccg caaggcgaac tggaggctgc gcgcgcctac       540
     ggcatgggac gctggacgac gttccggcgc atctggctgc cccgcgccgt ccaccgggcg       600
     ctgccgacgc tcaacggcga gaccgtgctg caactcaaat cgacaccgct cgtggcaacc       660
     atcaccgtgg tcgacgtcta tgcggtgatc tccaaggtgc ggcaggaaac ctttctcacc       720
     tacgagccgc tgctcttgct tgcgctcatc tatctgtgcc tgaccggcat tctggtcgtc       780
     gccttccgtt atttcgaaaa tcgcattccc acccgtggtg cctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page