(data stored in ACNUC7421 zone)

EMBL: CP001389.PE19

CP001389.PE19        Location/Qualifiers
FT   CDS_pept        complement(17493..18056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00190"
FT                   /product="putative OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23823"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK0"
FT                   /protein_id="ACP23823.1"
FT                   /translation="MSVTSTVSFKVSASLAAAGIGALIIASGALAQATSSRMKGMQLSN
FT                   DQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAGNMTVFYKATEGATITSGNADI
FT                   DRIEVNNKVFLSSGAQQATGDTGLVNLTNQTIVLKGDKVVLSEGKNVFVGCQLNVQMDT
FT                   GEAQLEACGGRVQIQLDPQSRKQN"
     atgtcggtca catctaccgt ttcttttaag gtttccgcca gcctggctgc cgccgggatc        60
     ggcgctttga taattgcttc cggcgccttg gcgcaggcca catccagccg catgaagggc       120
     atgcagcttt ccaacgacca gccgatccag atcgagagcg acaagctcga gataaaggac       180
     ccggaaagca aggcgatctt caccggcaac gtgaaggtcg tgcagggcac gacgacgctg       240
     caggccggca acatgaccgt cttctacaag gcgaccgagg gcgcgacgat caccagcggc       300
     aacgccgata tcgaccggat cgaggtcaac aacaaagtgt tcctgagttc cggcgcccaa       360
     caggcaacgg gcgataccgg cctcgtcaac cttaccaacc agactattgt gctcaagggc       420
     gacaaggtcg tcctgtccga gggcaagaac gtcttcgtcg gctgccagtt gaatgtgcaa       480
     atggatacgg gcgaagccca gctcgaggcc tgcggcggcc gcgtgcagat tcagctcgat       540
     ccgcagtccc gcaagcagaa ttga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page