(data stored in ACNUC7421 zone)

EMBL: CP001389.PE190

CP001389.PE190       Location/Qualifiers
FT   CDS_pept        complement(218898..219623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01940"
FT                   /product="putative amino acid ABC transporter, inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23994"
FT                   /db_xref="GOA:C3MFU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU3"
FT                   /protein_id="ACP23994.1"
FT                   /translation="MAADSLINWSLLALAAPGWGGVLLQGFLHSIEIAIGGYALGLLLG
FT                   VGGAFGKLYGGPVLRDLLECYTTIVRAVPELVLILLLYYAGTDLLNQFLGAMGIGTVDI
FT                   SGLMAGIFVIGVVQGAYSTEVLRGAIKAVPAGQIEAARAYGMSPTKVLRRITLPAMLPY
FT                   AIPGLANLWLIATKDTALLAVVGFSELTLVTRQAAGTTKAYFLFFCAAGALYLVLTLVS
FT                   NLFIGVIERHARRGFAERR"
     atggctgcgg attccctcat caactggagc ctgctggcgc tcgcggcgcc cggctggggc        60
     ggcgttctgt tgcagggctt cctgcattcg atcgagatcg ctatcggcgg ctatgcgctc       120
     ggattgctgc tcggcgtcgg cggcgccttc ggcaagctct acggcggacc ggtgctgcgc       180
     gacctgctcg agtgctatac gaccatcgtc cgcgccgttc ccgaactcgt cctcatcctg       240
     cttctctact atgccggcac cgacctcctg aaccagtttc tcggcgccat ggggatcggg       300
     accgtcgata tcagcggcct gatggccggc atcttcgtca tcggcgtcgt gcagggcgcc       360
     tattcgaccg aggtactgcg cggtgcgatc aaggcggtgc cggccgggca gatcgaggcg       420
     gcgcgggcct atgggatgtc gccgaccaag gttctcaggc gcatcaccct gcccgccatg       480
     ctgccctatg ctattccggg ccttgccaat ctgtggctga tcgccaccaa ggacacggcg       540
     ctgcttgccg tcgtcggctt cagcgaattg acgctcgtca cgcgccaggc ggccggtacc       600
     actaaggcgt acttcctctt cttctgcgcc gccggcgcgc tctatctcgt cctgacgctc       660
     gtctcgaacc tcttcatcgg cgtcatcgag cggcacgccc ggcgcggctt cgcggagcgg       720
     cgatga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page