(data stored in ACNUC7421 zone)

EMBL: CP001389.PE191

CP001389.PE191       Location/Qualifiers
FT   CDS_pept        complement(219788..220567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01950"
FT                   /product="putative ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23995"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU4"
FT                   /protein_id="ACP23995.1"
FT                   /translation="MKKTLKLLALAAALSLTGAAASAEQIKVGIAAEPYPPFTSPDANG
FT                   NWEGWEVEFMKAMCAEAKLDCVITPVAWDGIIPALTAKKIDMIVGSMSITAERLKTIDF
FT                   SDKYYNTPTGIMGTKGEDIKPTPEGLAGKTLGVQVSTVHQAYATKHFAPAGVEVKEYQT
FT                   QDEANQDLAAGRVDAVQADAIALEAFLKSDQGKECCDYKGEVAQDVDVLGPGVGVGLRK
FT                   GETELKDKINAAIKAIRDNGTYDTFSKKYFDFDIYGG"
     atgaagaaga cattgaagct cctggcgctc gccgccgccc tgtctctcac cggcgccgcc        60
     gcctcggccg aacagatcaa ggtcggcatt gccgccgaac cctacccgcc cttcacctcg       120
     ccggacgcga acggcaattg ggaaggctgg gaagtcgagt tcatgaaagc gatgtgcgcc       180
     gaggccaagc ttgactgcgt gatcacgccg gtcgcctggg acggcatcat tccggcgctg       240
     accgccaaga agatcgacat gatcgtcggc tcgatgtcga tcaccgcgga gcgcctgaag       300
     accatcgact tctccgacaa gtactacaac acgccgaccg gcatcatggg caccaagggc       360
     gaggacatca agccgacgcc ggaaggcctc gccggcaaga cgctcggcgt gcaggtctcg       420
     accgtgcacc aggcctatgc gacgaagcat ttcgccccgg ccggcgtcga ggtcaaggaa       480
     taccagacgc aggacgaagc gaaccaggat cttgcggccg gccgcgtcga tgccgtgcag       540
     gccgatgcga tcgctctcga agccttcctg aagagcgatc aaggcaagga atgctgcgac       600
     tacaagggcg aagtcgccca ggacgtcgac gtcctcggac caggcgtcgg cgtcggactg       660
     cgcaagggcg agaccgaact caaggacaag atcaacgcgg cgatcaaggc gatccgcgac       720
     aacggcacct acgacacctt ctcgaagaag tacttcgact tcgacattta cggcggctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page