(data stored in ACNUC7421 zone)

EMBL: CP001389.PE192

CP001389.PE192       Location/Qualifiers
FT   CDS_pept        complement(220604..221377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01960"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23996"
FT                   /db_xref="GOA:C3MFU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU5"
FT                   /protein_id="ACP23996.1"
FT                   /translation="MTDAAQAIAVTDLHKRFGPLEVLKGVSLNARQGDVIAIIGGSGSG
FT                   KSTFLRCINMLELPSAGRVSVHGEEIRMKPDGHGGLMPADRKQVQRIRTQLGMVFQSFN
FT                   LWQHMTILENVIEAPVHVLGKSRAEAVETAEKLLRRVGLFEKRDAYPAFLSGGQQQRAA
FT                   IARALAIQPLVMLFDEPTSALDPELVGEVLSVIGDLAREKRTMILVTHEMKFARDVASH
FT                   IVFLHNGLIEEQGPPEAIFGAPKSERLKKFISSIH"
     atgacggacg cggcccaggc aattgcggtc actgacctcc acaagcgttt cgggccattg        60
     gaagtgctga agggtgtatc gctgaacgcc cggcagggcg acgtcatcgc catcatcggc       120
     ggcagcggct cggggaaatc gaccttcctg cgctgcatca acatgctgga attgccctcg       180
     gccggccggg tctctgtcca cggcgaagaa atccgtatga agccggacgg ccacggcggg       240
     ttgatgcctg ccgaccgcaa gcaggtccag cgcatccgca cccagctcgg catggtgttc       300
     cagagcttca atctctggca gcacatgacc atcctcgaaa acgtcatcga ggctccggtc       360
     cacgtactcg gcaaatccag ggccgaggcg gtggaaacgg cggaaaagct gctgcgccgc       420
     gtcggactct ttgagaagcg tgacgcctat ccggccttcc tctccggcgg ccagcagcag       480
     cgcgccgcga tcgcccgggc tctggcgatc cagccgcttg tcatgctctt cgacgaaccg       540
     acctcggcgc ttgatccgga gctcgtcggc gaagttctct cggtgatcgg cgacctggcg       600
     cgcgagaaac ggacgatgat cctcgtcacc cacgagatga agttcgcccg cgacgtcgcc       660
     agccacatcg tcttcctgca caacggcctc atcgaggaac agggaccgcc cgaggccatc       720
     ttcggcgcgc cgaaatccga aaggctgaag aagttcatca gttcgattca ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page