(data stored in ACNUC7421 zone)

EMBL: CP001389.PE195

CP001389.PE195       Location/Qualifiers
FT   CDS_pept        223486..225099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01990"
FT                   /product="predicted thiamine pyrophosphate protein, TPP
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23999"
FT                   /db_xref="GOA:C3MFU8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU8"
FT                   /protein_id="ACP23999.1"
FT                   /translation="MSVETKTVGEVLVDLLEANGVEVVFGIPGVHTVELYRGLAASKIR
FT                   HVTPRHEQGAGFMADGYARVSGKPGVALVITGPGLTNTITAMAQARQDSIPMLVISGVN
FT                   RRDSLGHGRGLLHELPDQQGMMKTLALYSHTLINPADLPLVVDRAFAVLLSGRPGPVHI
FT                   EIPTDVMAERIESRGTKPAAATRPRSDGETLQRAAILCAEASRPVILCGGGALTAEAEV
FT                   RGLAEQIGAPVVTTVNARGMLAGHPLRVPASPSLKAVRALLRDADLVLALGTEMGQTDY
FT                   DLYADGGFPMLRNLIRTDIDAAQLARGPQAALSVLSGARAATAGILGFLPGHTAARDGA
FT                   SRADATRKAALKELTPKMRAEVGIIDLIYKALPDCTIVGDSTQAVYAGNLYCDAPRQRA
FT                   WFNSATGYGSLGYAPPAAVGAAVADRARPVVCLVGDGGFQFSLAEIGSAVDAGARVIFL
FT                   VWNNDGYREIESHMVEAGVTPEGVKPSAPDFLLTAGAYGVPAERLAKIGDLPRALADAA
FT                   SRSGPSLIEIHQEKTAGVGG"
     atgagtgtcg aaacgaagac agtcggcgag gtcctcgtcg atctgctcga ggcaaacggc        60
     gtcgaagtgg tgttcggcat tccaggcgtt cacacggtcg agctttatcg cggcttggca       120
     gcgtcgaaga tccgccacgt cacgccgcgc cacgagcagg gcgccggctt catggccgac       180
     ggctatgcgc gcgtcagcgg caagccgggc gtggcactgg tcatcaccgg gccgggtctc       240
     accaacacga tcacggcaat ggcgcaggcg cggcaggatt cgatcccgat gctggtcatt       300
     tccggcgtca accggcgcga ctcgctgggg cacggccgcg gcctgctgca cgaattgccg       360
     gaccagcagg gaatgatgaa gaccctggcc ctctattcgc acacgctgat caatccggcc       420
     gacctgccgc tggtcgtcga ccgcgccttt gcggtgctgc tttccggccg accagggccg       480
     gtgcatatcg agattccgac cgatgtgatg gccgagcgga tcgaaagcag ggggacaaag       540
     ccggcggcgg cgacccggcc gcgctccgac ggcgaaacct tgcagagagc ggcgatcctc       600
     tgcgcggaag cctcgcgccc cgtcattctc tgcggtggcg gcgcgctgac ggcggaggcc       660
     gaagtgcgcg ggcttgccga gcagatcggc gcgccggtgg tcacgaccgt caatgcccgc       720
     ggcatgctgg ccggtcatcc cctgcgcgtt ccggcaagcc cgagcctcaa ggcggtccgc       780
     gccttgctgc gcgacgccga tctcgtgctg gcgctcggca cggagatggg ccagaccgac       840
     tacgaccttt atgccgatgg cggctttccc atgctccgca acctaatccg caccgatatc       900
     gatgccgccc aattggcacg cgggccgcag gcggcgctgt cggttctttc gggggcaagg       960
     gccgcgacgg cgggcattct gggtttcctg cccggccata cggcggccag ggacggcgca      1020
     tcgcgggcgg atgcgacgcg caaggcggca ctgaaggaat tgacgccgaa gatgcgcgcc      1080
     gaagtcggta tcatcgacct gatctacaag gcgctacccg actgcacgat cgtcggcgat      1140
     tcgacccagg ccgtctatgc cggcaacctc tactgcgatg cgccgcggca gcgcgcctgg      1200
     ttcaactccg ccaccggcta tggttcgctc ggctatgccc ctccggcggc ggtgggcgcg      1260
     gcggttgccg accgcgcgag gccggtcgtc tgccttgtcg gcgacggcgg cttccagttt      1320
     tcgctggccg agatcggctc tgcggtcgac gccggagcga gggtgatctt cctcgtctgg      1380
     aacaatgacg gataccggga gatcgaatcc cacatggtcg aggccggcgt cacgccggaa      1440
     ggcgtgaagc cctcggcgcc ggatttcctg ttgaccgccg gggcctatgg cgtcccggcc      1500
     gagcggttgg cgaagatcgg ggacctgccg cgtgcgctgg ccgatgccgc ctcgcggtcg      1560
     ggtccgtcgc tgatcgagat ccaccaggag aaaaccgccg gtgtcggcgg ctga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page